DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and Zif

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001189188.1 Gene:Zif / 40795 FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster


Alignment Length:180 Identity:56/180 - (31%)
Similarity:88/180 - (48%) Gaps:7/180 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 LQAHEKTHKSPRYECA--DCGKGFSQLRNYKYH-----LSVHRGTKEFAAECPECGKTFNDKGYL 370
            |::.::..::|..:.|  :..|...:.|..:..     |:...||::....|..||..:..:|.:
  Fly   174 LESEKQYEETPSQQLALQEAAKASLKARRGRVRRGLNSLTTSDGTEKGGYICDVCGNFYEKRGRM 238

  Fly   371 SSHLKIHRNRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRFSRKMLLKQHMRTHSG 435
            ..|.:.|....:|.|..|...|..|.....|:..|||.||:||:.|.::|..:.:||.|...|.|
  Fly   239 MEHRRRHDGICQYACELCDAKFQVREQLRKHMYSHTGSKPYKCSFCSRQFFYESVLKSHENVHRG 303

  Fly   436 EKPYQCSVCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTH 485
            .|||.|.||.|:||...::|.|..:||.||.:.|..|.|.|...||::.|
  Fly   304 IKPYVCKVCDKAFAYAHSLTKHELIHSDIKLYRCDYCNKDFRLLHHMRQH 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 1/6 (17%)
COG5048 <316..502 CDD:227381 55/177 (31%)
C2H2 Zn finger 327..347 CDD:275368 4/26 (15%)
zf-C2H2 356..377 CDD:278523 5/20 (25%)
C2H2 Zn finger 357..377 CDD:275368 5/19 (26%)
zf-H2C2_2 369..394 CDD:290200 6/24 (25%)
C2H2 Zn finger 385..405 CDD:275368 5/19 (26%)
zf-H2C2_2 397..422 CDD:290200 10/24 (42%)
C2H2 Zn finger 413..433 CDD:275368 6/19 (32%)
zf-H2C2_2 426..449 CDD:290200 12/22 (55%)
zf-C2H2 439..461 CDD:278523 9/21 (43%)
C2H2 Zn finger 441..461 CDD:275368 8/19 (42%)
zf-C2H2 467..489 CDD:278523 7/19 (37%)
C2H2 Zn finger 469..489 CDD:275368 7/17 (41%)
C2H2 Zn finger 497..515 CDD:275368
ZifNP_001189188.1 zf-AD 9..87 CDD:285071
C2H2 Zn finger 225..245 CDD:275368 5/19 (26%)
COG5048 <250..369 CDD:227381 42/104 (40%)
C2H2 Zn finger 253..273 CDD:275368 5/19 (26%)
zf-H2C2_2 266..288 CDD:290200 9/21 (43%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
zf-H2C2_2 294..318 CDD:290200 13/23 (57%)
C2H2 Zn finger 309..329 CDD:275368 8/19 (42%)
C2H2 Zn finger 337..353 CDD:275368 6/15 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457850
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.