DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and CG14667

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001014607.1 Gene:CG14667 / 40643 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster


Alignment Length:155 Identity:47/155 - (30%)
Similarity:71/155 - (45%) Gaps:8/155 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 ETLQAHEKTHKSPR----YECADCGKGFSQLRNYKYHLSVHRGTKEFAA--ECPECGKTFNDKGY 369
            |.||..|....:.|    :.|.:||..|.....|..||:.|:..::...  .||||.:|||.|..
  Fly   159 EDLQEQEMERAAKRRSNFFICDECGTLFHDAFLYTEHLNGHQNRRDMNQFFPCPECPQTFNKKAL 223

  Fly   370 LSSH-LKIHRNRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRFSRKMLLKQHMRTH 433
            |..| .::|...:.::|..|.::|....|...|.:.|...:|:.|.|||..||....|:.|..||
  Fly   224 LKQHRTQVHLINRRFQCTICHEAFASLGAKLRHDKAHKNERPYPCLECGMIFSSVSELQNHFSTH 288

  Fly   434 SGE-KPYQCSVCGKSFADRSNMTLH 457
            |.: :.::|..|...|..|..:..|
  Fly   289 SKQIRKFRCEPCNMDFITRRGLVAH 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 4/8 (50%)
COG5048 <316..502 CDD:227381 44/150 (29%)
C2H2 Zn finger 327..347 CDD:275368 7/19 (37%)
zf-C2H2 356..377 CDD:278523 10/21 (48%)
C2H2 Zn finger 357..377 CDD:275368 10/20 (50%)
zf-H2C2_2 369..394 CDD:290200 6/25 (24%)
C2H2 Zn finger 385..405 CDD:275368 5/19 (26%)
zf-H2C2_2 397..422 CDD:290200 9/24 (38%)
C2H2 Zn finger 413..433 CDD:275368 8/19 (42%)
zf-H2C2_2 426..449 CDD:290200 7/23 (30%)
zf-C2H2 439..461 CDD:278523 5/19 (26%)
C2H2 Zn finger 441..461 CDD:275368 5/17 (29%)
zf-C2H2 467..489 CDD:278523
C2H2 Zn finger 469..489 CDD:275368
C2H2 Zn finger 497..515 CDD:275368
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871
C2H2 Zn finger 179..199 CDD:275368 7/19 (37%)
C2H2 Zn finger 211..232 CDD:275368 10/20 (50%)
C2H2 Zn finger 240..260 CDD:275368 5/19 (26%)
zf-C2H2_8 243..313 CDD:292531 21/69 (30%)
C2H2 Zn finger 268..288 CDD:275368 8/19 (42%)
C2H2 Zn finger 297..316 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004498
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.