DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG15269 and snai2

DIOPT Version :9

Sequence 1:	NP_609739.2	Gene:	CG15269 / 34887	FlyBaseID:	FBgn0028878	Length:	587	Species:	Drosophila melanogaster
Sequence 2:	NP_989424.1	Gene:	snai2 / 395065	XenbaseID:	XB-GENE-487371	Length:	266	Species:	Xenopus tropicalis

Alignment Length:	140	Identity:	57/140 - (40%)
Similarity:	82/140 - (58%)	Gaps:	7/140 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly   356 ECPECGKTFNDKGYLSSHLKIH---RNRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECG 417
            :|..|.||::....|:.|.::|   ::||.:.|.||.|.:....|..||:|.||  .|..|..||
Frog   127 QCSLCSKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCEKEYVSLGALKMHIRTHT--LPCVCKICG 189

  Fly   418 KRFSRKMLLKQHMRTHSGEKPYQCSVCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHL 482
            |.|||..||:.|:|||:||||:.|..|.::||||||:..|.:.||.:|.:.|..|.|.|::...|
Frog   190 KAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLL 254

  Fly   483 KTHLNYHTGC 492
              |.:..:||
Frog   255 --HKHEESGC 262

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG15269	NP_609739.2	C2H2 Zn finger	300..320	CDD:275368
		COG5048	<316..502	CDD:227381	57/140 (41%)
		C2H2 Zn finger	327..347	CDD:275368
		zf-C2H2	356..377	CDD:278523	6/20 (30%)
		C2H2 Zn finger	357..377	CDD:275368	6/19 (32%)
		zf-H2C2_2	369..394	CDD:290200	9/27 (33%)
		C2H2 Zn finger	385..405	CDD:275368	8/19 (42%)
		zf-H2C2_2	397..422	CDD:290200	12/24 (50%)
		C2H2 Zn finger	413..433	CDD:275368	11/19 (58%)
		zf-H2C2_2	426..449	CDD:290200	11/22 (50%)
		zf-C2H2	439..461	CDD:278523	9/21 (43%)
		C2H2 Zn finger	441..461	CDD:275368	9/19 (47%)
		zf-C2H2	467..489	CDD:278523	6/21 (29%)
		C2H2 Zn finger	469..489	CDD:275368	6/19 (32%)
		C2H2 Zn finger	497..515	CDD:275368
snai2	NP_989424.1	DUF4764	82..>160	CDD:292583	9/32 (28%)
		C2H2 Zn finger	128..148	CDD:275370	6/19 (32%)
		C2H2 Zn finger	159..179	CDD:275368	8/19 (42%)
		C2H2 Zn finger	185..205	CDD:275368	11/19 (58%)
		zf-H2C2_2	198..221	CDD:290200	11/22 (50%)
		zf-C2H2	211..233	CDD:278523	9/21 (43%)
		C2H2 Zn finger	213..233	CDD:275368	9/19 (47%)
		zf-H2C2_2	225..250	CDD:290200	9/24 (38%)
		C2H2 Zn finger	241..257	CDD:275368	6/17 (35%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910