| Sequence 1: | NP_609739.2 | Gene: | CG15269 / 34887 | FlyBaseID: | FBgn0028878 | Length: | 587 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_612040.1 | Gene: | Kah / 38072 | FlyBaseID: | FBgn0035144 | Length: | 442 | Species: | Drosophila melanogaster |
| Alignment Length: | 296 | Identity: | 96/296 - (32%) |
|---|---|---|---|
| Similarity: | 127/296 - (42%) | Gaps: | 65/296 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 343 HLSVH----------RGTKEFAAE--CPECGKTFNDKGYLSSHLKIHR---NRKEYECPYCPKSF 392
Fly 393 NQRVAFNMHVRIHTGVKPHKCNECGKRFSRKMLLKQHMRTHSGEKPYQCSVCGKSFADRSNMTLH 457
Fly 458 HRLHSGIKPFSCPLCPKAFTKKHHLKTHLNYHTGCKPYVCPHPNCNQAFTQSSNMRTHAKKCQYR 522
Fly 523 PLDGLTVTSSALPVPGK-------QQTGPPPTLAMAM----------AQTFQ-MPPPP------- 562
Fly 563 --------------GVLTPGSGPSQPPS-QQTLLSN 583 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG15269 | NP_609739.2 | C2H2 Zn finger | 300..320 | CDD:275368 | |
| COG5048 | <316..502 | CDD:227381 | 70/173 (40%) | ||
| C2H2 Zn finger | 327..347 | CDD:275368 | 2/3 (67%) | ||
| zf-C2H2 | 356..377 | CDD:278523 | 9/22 (41%) | ||
| C2H2 Zn finger | 357..377 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 369..394 | CDD:290200 | 10/27 (37%) | ||
| C2H2 Zn finger | 385..405 | CDD:275368 | 10/19 (53%) | ||
| zf-H2C2_2 | 397..422 | CDD:290200 | 12/24 (50%) | ||
| C2H2 Zn finger | 413..433 | CDD:275368 | 12/19 (63%) | ||
| zf-H2C2_2 | 426..449 | CDD:290200 | 13/22 (59%) | ||
| zf-C2H2 | 439..461 | CDD:278523 | 10/21 (48%) | ||
| C2H2 Zn finger | 441..461 | CDD:275368 | 10/19 (53%) | ||
| zf-C2H2 | 467..489 | CDD:278523 | 8/21 (38%) | ||
| C2H2 Zn finger | 469..489 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 497..515 | CDD:275368 | 4/17 (24%) | ||
| Kah | NP_612040.1 | zf-C2H2 | 119..141 | CDD:278523 | 8/21 (38%) |
| C2H2 Zn finger | 121..141 | CDD:275368 | 8/19 (42%) | ||
| zf-C2H2 | 176..198 | CDD:278523 | 12/21 (57%) | ||
| C2H2 Zn finger | 178..198 | CDD:275368 | 12/19 (63%) | ||
| zf-H2C2_2 | 191..214 | CDD:290200 | 13/22 (59%) | ||
| zf-C2H2 | 204..226 | CDD:278523 | 10/21 (48%) | ||
| C2H2 Zn finger | 206..226 | CDD:275368 | 10/19 (53%) | ||
| zf-H2C2_2 | 218..242 | CDD:290200 | 10/23 (43%) | ||
| C2H2 Zn finger | 234..250 | CDD:275368 | 7/15 (47%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||