DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and CG10543

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001369100.1 Gene:CG10543 / 37379 FlyBaseID:FBgn0034570 Length:1666 Species:Drosophila melanogaster


Alignment Length:646 Identity:149/646 - (23%)
Similarity:235/646 - (36%) Gaps:188/646 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 TSTNILDLSKSSSN--SIRSPQALGGLAIPSTPYASG--AYSMLPPDLV----AMANATKFYAQF 110
            ||:|.:..:.::||  |:..||.        ||.|..  |.||.|.|.:    .|.|.       
  Fly   499 TSSNSISNNNNNSNNVSLHRPQL--------TPQAQNQLAASMKPSDHIPISMPMENM------- 548

  Fly   111 FPHLLPAYAAAAAAAGLSTPPTSPYQTHQHQQHLPNQQKRFFAPYVINGSVPPPPPLQQQQQPLI 175
              .|....||...|..:....:|...:..|||..|.....  .|..:.|.:     :|||||..:
  Fly   549 --DLKAGQAAHGTANAIMQGGSSSLASQLHQQQKPYNSSN--NPLSMMGGM-----MQQQQQQHV 604

  Fly   176 RTKSTACTRPDCPECLDYYQRLQTGGYKQTAPLISPAAS-----SVSSSTGSIRPVRDLIMSA-- 233
            ............||  |:.|...:....:..|.::..::     ::|....|...:.|..:||  
  Fly   605 AMPHHQRQMMMMPE--DFPQHGASMMNSRQMPALAALSNLGDTPAMSGQLNSSLELDDNDLSADE 667

  Fly   234 --------------------TGGAASTNISLTTVTNLSLNSVQATAVGMMPKMTGGLITTAVGSN 278
                                .||::|:            .|:||.     |...|          
  Fly   668 DDDDLDHDLDELDAAKQQLIDGGSSSS------------TSLQAP-----PSQHG---------- 705

  Fly   279 SGAIGGIGGYN-ATSAEEISYKCRICEKVFGCSETLQAHEKTHKSPRYECADCG-KGFSQLRNYK 341
            ||: ||.||.. .:..::.||.|.:|.|.:...::|..|.|.|  |.| |.||| :..:.|....
  Fly   706 SGS-GGSGGQTPGSKKDKPSYNCLLCPKSYRKRKSLLDHYKMH--PGY-CHDCGQRNGNTLEEII 766

  Fly   342 YH-LSVHRGTKEFAAECPECGKTFNDKGYLSSHLKIHRNRKEYE--------------------- 384
            :| .::|  .|||...|..||::::.|....:|::.| |:||.:                     
  Fly   767 HHNRTMH--VKEFPFVCETCGESYSRKQQFHAHVESH-NKKEIKTFPCGECGLKFPQKKLQQHFE 828

  Fly   385 ----------CPYCPKSFNQRVAFNMH-VRIHTGVKPHKCNECGKRFSRKMLLKQHMRTHSG-EK 437
                      |..|.:.|..:.|...| :|:|......:|:.|..||:.|..|::|::.|:. ::
  Fly   829 ETGHKADGAICEVCGEEFQSKNALYQHIIRVHKRDNFFECHICHNRFTLKANLERHVQLHTEIKR 893

  Fly   438 PYQCSVCGKSFADRSNMTLHH-RLHSGIKPFSCPLCPKAFTKKHHLKTHLNYHTGCKPYVCPHPN 501
            ||.|.:||.|:.....:..|: ..|..:....|.||.|.|.....|:.||..|:..:|:.|.:  
  Fly   894 PYVCDLCGSSYFTYPALKEHYSNAHVDVSECKCTLCGKRFGSAKSLQRHLPSHSEERPHCCNY-- 956

  Fly   502 CNQAFTQSSNMRTHAKKCQYRPLDGLTVTSSALPVP--GKQQ---------------TGPPPTLA 549
            |:|.|...:::..|.:          |:..:..|.|  |||:               .||||..|
  Fly   957 CDQTFKWKTHLVRHKQ----------TMHGNEPPPPKKGKQRFPKTSEEDMGSLPDMPGPPPVKA 1011

  Fly   550 MAMAQTFQ---------------------------MPPPPGVLTPGSGPSQPPSQQTLLSN 583
            ...|.|.:                           .||||...|||.....|.:...:.||
  Fly  1012 SKKAATSKAKAQAAAAAAAAASSQQQQQKGSAATPTPPPPVSTTPGCLQQDPFNAAMVSSN 1072

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 6/19 (32%)
COG5048 <316..502 CDD:227381 58/221 (26%)
C2H2 Zn finger 327..347 CDD:275368 6/21 (29%)
zf-C2H2 356..377 CDD:278523 5/20 (25%)
C2H2 Zn finger 357..377 CDD:275368 5/19 (26%)
zf-H2C2_2 369..394 CDD:290200 8/55 (15%)
C2H2 Zn finger 385..405 CDD:275368 6/20 (30%)
zf-H2C2_2 397..422 CDD:290200 8/25 (32%)
C2H2 Zn finger 413..433 CDD:275368 7/19 (37%)
zf-H2C2_2 426..449 CDD:290200 9/23 (39%)
zf-C2H2 439..461 CDD:278523 6/22 (27%)
C2H2 Zn finger 441..461 CDD:275368 5/20 (25%)
zf-C2H2 467..489 CDD:278523 8/21 (38%)
C2H2 Zn finger 469..489 CDD:275368 8/19 (42%)
C2H2 Zn finger 497..515 CDD:275368 4/17 (24%)
CG10543NP_001369100.1 C2H2 Zn finger 727..747 CDD:275368 6/19 (32%)
C2H2 Zn finger 751..773 CDD:275368 6/21 (29%)
C2H2 Zn finger 781..801 CDD:275368 5/19 (26%)
PHA00733 <804..860 CDD:177301 8/55 (15%)
C2H2 Zn finger 811..827 CDD:275368 0/15 (0%)
C2H2 Zn finger 839..860 CDD:275368 6/20 (30%)
C2H2 Zn finger 868..888 CDD:275368 7/19 (37%)
C2H2 Zn finger 897..913 CDD:275368 4/15 (27%)
C2H2 Zn finger 926..946 CDD:275368 8/19 (42%)
C2H2 Zn finger 954..975 CDD:275368 6/32 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.