DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and Sp9

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001178831.1 Gene:Sp9 / 366078 RGDID:1559457 Length:485 Species:Rattus norvegicus


Alignment Length:465 Identity:108/465 - (23%)
Similarity:158/465 - (33%) Gaps:163/465 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 KSSSNSIRSPQALGGLAIPSTPYASG-----------AYSMLPPDLVAMANATKFYAQFFPHLLP 116
            |.||:|.....:|.|.|:.:....||           |:.:......:.|.::. |...|.:   
  Rat    51 KRSSSSCNLGSSLSGFAVATGGRGSGSLAGGSGAANSAFCLASTSPTSSAFSSD-YGGLFSN--- 111

  Fly   117 AYAAAAAAAGLSTPPTSPYQTHQHQQHLPNQQKRFFAPYVINGSVPPPPPLQQQQQPLIRTKSTA 181
            :.||||||||:|............:.|..          ..:|..|                ...
  Rat   112 SAAAAAAAAGVSPQEAGGQSAFISKVHTT----------AADGLYP----------------RVG 150

  Fly   182 CTRPDCPECLDYYQRLQTGGYKQT---APLISPAASS---VSSSTGS----IRPVRDLIMSATGG 236
            ...|        |:.....|:..|   ..:.:.||||   |.||.||    ..|...|..|...|
  Rat   151 MAHP--------YESWYKSGFHSTLAAGEVTNGAASSWWDVHSSPGSWLEVQNPAGGLQSSLHSG 207

  Fly   237 A--ASTNISLTT----VTNLSLNSVQATAVG------------------------MMPKMTGGLI 271
            |  ||.:..|.|    .::|:.::..:|.:|                        ::|..:....
  Rat   208 APQASLHSQLGTYNPDFSSLTHSAFSSTGLGSSAAAASHLLSTSQHLLAQDGFKPVLPSYSDSSA 272

  Fly   272 TTAVGSNSGAIGG-----IGGYNATSAEEISYKCRICEKVFGCSETLQAHEKTHKSPRYECADC- 330
            ..|..:.|..|.|     .||.:|.||...|.:..       |                :|.:| 
  Rat   273 AVAAAAASAMISGAAAAAAGGSSARSARRYSGRAT-------C----------------DCPNCQ 314

  Fly   331 -----GKGFSQLRNYKYHLSVHRGTKEFAAECPECGKTFNDKGYLSSHLKIHRNRKEYECPYCPK 390
                 |...:.||....| |.|         .|.|||.:..    :||||               
  Rat   315 EAERLGPAGASLRRKGLH-SCH---------IPGCGKVYGK----TSHLK--------------- 350

  Fly   391 SFNQRVAFNMHVRIHTGVKPHKCN--ECGKRFSRKMLLKQHMRTHSGEKPYQCSVCGKSFADRSN 453
                     .|:|.|||.:|..||  .|||||:|...|::|:|||:|||.:.|.||.|.|....:
  Rat   351 ---------AHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFACPVCNKRFMRSDH 406

  Fly   454 MTLHHRLHSG 463
            ::.|.:.|:|
  Rat   407 LSKHIKTHNG 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 1/19 (5%)
COG5048 <316..502 CDD:227381 46/156 (29%)
C2H2 Zn finger 327..347 CDD:275368 7/25 (28%)
zf-C2H2 356..377 CDD:278523 8/20 (40%)
C2H2 Zn finger 357..377 CDD:275368 8/19 (42%)
zf-H2C2_2 369..394 CDD:290200 4/24 (17%)
C2H2 Zn finger 385..405 CDD:275368 2/19 (11%)
zf-H2C2_2 397..422 CDD:290200 13/26 (50%)
C2H2 Zn finger 413..433 CDD:275368 11/21 (52%)
zf-H2C2_2 426..449 CDD:290200 12/22 (55%)
zf-C2H2 439..461 CDD:278523 6/21 (29%)
C2H2 Zn finger 441..461 CDD:275368 6/19 (32%)
zf-C2H2 467..489 CDD:278523
C2H2 Zn finger 469..489 CDD:275368
C2H2 Zn finger 497..515 CDD:275368
Sp9NP_001178831.1 SP6-9_N 19..333 CDD:425402 68/343 (20%)
C2H2 Zn finger 337..356 CDD:275368 10/46 (22%)
zf-H2C2_2 348..375 CDD:404364 16/50 (32%)
C2H2 Zn finger 364..386 CDD:275368 11/21 (52%)
zf-H2C2_2 378..401 CDD:404364 12/22 (55%)
zf-C2H2 392..414 CDD:395048 6/21 (29%)
C2H2 Zn finger 394..414 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.