| Sequence 1: | NP_609739.2 | Gene: | CG15269 / 34887 | FlyBaseID: | FBgn0028878 | Length: | 587 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001102375.1 | Gene: | Zfp524 / 365179 | RGDID: | 1565485 | Length: | 314 | Species: | Rattus norvegicus |
| Alignment Length: | 206 | Identity: | 59/206 - (28%) |
|---|---|---|---|
| Similarity: | 87/206 - (42%) | Gaps: | 42/206 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 380 RKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRFSRKMLLKQHMRTHSGEKPYQCSVC 444
Fly 445 GKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTHLNYH----TGCKPYVCPHPNCN-- 503
Fly 504 -----------QAFTQSSNMRTHAKKCQY-----RPLDGLTVTSSA----------------LP- 535
Fly 536 VPGKQQTGPPP 546 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG15269 | NP_609739.2 | C2H2 Zn finger | 300..320 | CDD:275368 | |
| COG5048 | <316..502 | CDD:227381 | 42/125 (34%) | ||
| C2H2 Zn finger | 327..347 | CDD:275368 | |||
| zf-C2H2 | 356..377 | CDD:278523 | |||
| C2H2 Zn finger | 357..377 | CDD:275368 | |||
| zf-H2C2_2 | 369..394 | CDD:290200 | 5/13 (38%) | ||
| C2H2 Zn finger | 385..405 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 397..422 | CDD:290200 | 10/24 (42%) | ||
| C2H2 Zn finger | 413..433 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 426..449 | CDD:290200 | 7/22 (32%) | ||
| zf-C2H2 | 439..461 | CDD:278523 | 6/21 (29%) | ||
| C2H2 Zn finger | 441..461 | CDD:275368 | 6/19 (32%) | ||
| zf-C2H2 | 467..489 | CDD:278523 | 7/21 (33%) | ||
| C2H2 Zn finger | 469..489 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 497..515 | CDD:275368 | 6/30 (20%) | ||
| Zfp524 | NP_001102375.1 | COG5048 | <102..218 | CDD:227381 | 38/111 (34%) |
| C2H2 Zn finger | 111..131 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 123..148 | CDD:290200 | 10/24 (42%) | ||
| C2H2 Zn finger | 139..159 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 151..174 | CDD:290200 | 7/22 (32%) | ||
| C2H2 Zn finger | 167..187 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 179..203 | CDD:290200 | 10/23 (43%) | ||
| C2H2 Zn finger | 195..216 | CDD:275368 | 7/20 (35%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||