Sequence 1: | NP_609739.2 | Gene: | CG15269 / 34887 | FlyBaseID: | FBgn0028878 | Length: | 587 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001023030.2 | Gene: | ZK686.5 / 3565160 | WormBaseID: | WBGene00022795 | Length: | 263 | Species: | Caenorhabditis elegans |
Alignment Length: | 264 | Identity: | 57/264 - (21%) |
---|---|---|---|
Similarity: | 80/264 - (30%) | Gaps: | 102/264 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 121 AAAAAGL--------STPPTSPYQTHQHQQHLPNQQKRFFAPYVINGSVPPPPPLQQQQQPLIRT 177
Fly 178 KSTACTRPDCPECLDYYQRLQTGGYKQTAPLISPAASSVSSSTGSIRPV-RDLIMSATGGAASTN 241
Fly 242 ISLTTVTNLSLNSVQATAVGMMPKMTGGLITTAVGSNSGAIGGIGGYNATSAEEISYKCRICEKV 306
Fly 307 FGCSETLQAHE-KTHKSPRYECADCGKGFSQLRNYKYHLSVHRG-TKEFAAECPECGKTFNDKGY 369
Fly 370 LSSH 373 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15269 | NP_609739.2 | C2H2 Zn finger | 300..320 | CDD:275368 | 8/20 (40%) |
COG5048 | <316..502 | CDD:227381 | 21/60 (35%) | ||
C2H2 Zn finger | 327..347 | CDD:275368 | 7/19 (37%) | ||
zf-C2H2 | 356..377 | CDD:278523 | 7/18 (39%) | ||
C2H2 Zn finger | 357..377 | CDD:275368 | 7/17 (41%) | ||
zf-H2C2_2 | 369..394 | CDD:290200 | 2/5 (40%) | ||
C2H2 Zn finger | 385..405 | CDD:275368 | |||
zf-H2C2_2 | 397..422 | CDD:290200 | |||
C2H2 Zn finger | 413..433 | CDD:275368 | |||
zf-H2C2_2 | 426..449 | CDD:290200 | |||
zf-C2H2 | 439..461 | CDD:278523 | |||
C2H2 Zn finger | 441..461 | CDD:275368 | |||
zf-C2H2 | 467..489 | CDD:278523 | |||
C2H2 Zn finger | 469..489 | CDD:275368 | |||
C2H2 Zn finger | 497..515 | CDD:275368 | |||
ZK686.5 | NP_001023030.2 | C2H2 Zn finger | 173..194 | CDD:275368 | 8/20 (40%) |
C2H2 Zn finger | 201..221 | CDD:275368 | 7/19 (37%) | ||
zf-C2H2_8 | <204..251 | CDD:292531 | 15/45 (33%) | ||
C2H2 Zn finger | 232..248 | CDD:275368 | 6/15 (40%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |