Sequence 1: | NP_609739.2 | Gene: | CG15269 / 34887 | FlyBaseID: | FBgn0028878 | Length: | 587 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_872439.2 | Gene: | ZNF713 / 349075 | HGNCID: | 22043 | Length: | 443 | Species: | Homo sapiens |
Alignment Length: | 261 | Identity: | 94/261 - (36%) |
---|---|---|---|
Similarity: | 134/261 - (51%) | Gaps: | 13/261 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 249 NLSLNSVQATAVGMMPKMTGGLITTAVGSNSGAIGGIGGYNATSAEEISYKCRICEKVFGCSETL 313
Fly 314 QAHEKTHKSPRYECADCGKGFSQLRNYKYHLSVHRGTKEFAAECPECGKTFNDKGYLSSHLKIHR 378
Fly 379 NRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRFSRKMLLKQHMRTHSGEKPYQCSV 443
Fly 444 CGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTHLNYHTGCKPYVCPHPNCNQAFTQ 508
Fly 509 S 509 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15269 | NP_609739.2 | C2H2 Zn finger | 300..320 | CDD:275368 | 5/19 (26%) |
COG5048 | <316..502 | CDD:227381 | 76/185 (41%) | ||
C2H2 Zn finger | 327..347 | CDD:275368 | 5/19 (26%) | ||
zf-C2H2 | 356..377 | CDD:278523 | 8/20 (40%) | ||
C2H2 Zn finger | 357..377 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 369..394 | CDD:290200 | 9/24 (38%) | ||
C2H2 Zn finger | 385..405 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 397..422 | CDD:290200 | 16/24 (67%) | ||
C2H2 Zn finger | 413..433 | CDD:275368 | 11/19 (58%) | ||
zf-H2C2_2 | 426..449 | CDD:290200 | 13/22 (59%) | ||
zf-C2H2 | 439..461 | CDD:278523 | 9/21 (43%) | ||
C2H2 Zn finger | 441..461 | CDD:275368 | 8/19 (42%) | ||
zf-C2H2 | 467..489 | CDD:278523 | 8/21 (38%) | ||
C2H2 Zn finger | 469..489 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 497..515 | CDD:275368 | 4/13 (31%) | ||
ZNF713 | NP_872439.2 | KRAB | 32..91 | CDD:214630 | |
KRAB | 32..71 | CDD:279668 | |||
C2H2 Zn finger | 261..280 | CDD:275368 | 5/18 (28%) | ||
COG5048 | 284..>349 | CDD:227381 | 30/66 (45%) | ||
zf-C2H2 | 286..308 | CDD:278523 | 8/23 (35%) | ||
C2H2 Zn finger | 288..308 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 300..325 | CDD:290200 | 9/24 (38%) | ||
C2H2 Zn finger | 316..336 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 328..353 | CDD:290200 | 16/24 (67%) | ||
C2H2 Zn finger | 344..364 | CDD:275368 | 11/19 (58%) | ||
zf-H2C2_2 | 356..381 | CDD:290200 | 14/24 (58%) | ||
C2H2 Zn finger | 372..392 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 384..409 | CDD:290200 | 11/24 (46%) | ||
C2H2 Zn finger | 400..420 | CDD:275368 | 8/19 (42%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24384 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |