DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and ZNF81

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001365081.1 Gene:ZNF81 / 347344 HGNCID:13156 Length:661 Species:Homo sapiens


Alignment Length:285 Identity:104/285 - (36%)
Similarity:138/285 - (48%) Gaps:61/285 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 YNATSAEEISYKCRIC-------------------EKVFGCSE---------TLQAHEKTHKSPR 324
            :..|...|..|||..|                   ||:|.|||         .|..|:|.|...|
Human   348 HEKTHTREKPYKCNECGKSFFQVSSLLRHQTTHTGEKLFECSECGKGFSLNSALNIHQKIHTGER 412

  Fly   325 -YECADCGKGFSQLRNYKYHLSVHRGTKEFAAECPECGKTFNDKGYLSSHLKIHRNRKEYECPYC 388
             ::|::|||.|:|....:.|..:|.|.:.:.  |.:||:.|..|.:|.:|.:||...|.|||..|
Human   413 HHKCSECGKAFTQKSTLRMHQRIHTGERSYI--CTQCGQAFIQKAHLIAHQRIHTGEKPYECSDC 475

  Fly   389 PKSFNQRVAFNMHVRIHTGVKPHKCNECGKRFSRKMLLKQHMRTHSGEKPYQCSVCGKSFADRSN 453
            .|||..:....||.|||||.||:.|.||||.|:.:..|..|.::|:|||.|.|:.|||:|.||||
Human   476 GKSFPSKSQLQMHKRIHTGEKPYICTECGKAFTNRSNLNTHQKSHTGEKSYICAECGKAFTDRSN 540

  Fly   454 ----------------------------MTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTHLNYHT 490
                                        :..|.|:|:..||:.||.|.|:|:||.|||.|...||
Human   541 FNKHQTIHTGEKPYVCADCGRAFIQKSELITHQRIHTTEKPYKCPDCEKSFSKKPHLKVHQRIHT 605

  Fly   491 GCKPYVCPHPNCNQAFTQSSNMRTH 515
            |.|||:|  ..|.:|||..||...|
Human   606 GEKPYIC--AECGKAFTDRSNFNKH 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 11/47 (23%)
COG5048 <316..502 CDD:227381 84/214 (39%)
C2H2 Zn finger 327..347 CDD:275368 7/19 (37%)
zf-C2H2 356..377 CDD:278523 7/20 (35%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
zf-H2C2_2 369..394 CDD:290200 12/24 (50%)
C2H2 Zn finger 385..405 CDD:275368 8/19 (42%)
zf-H2C2_2 397..422 CDD:290200 15/24 (63%)
C2H2 Zn finger 413..433 CDD:275368 8/19 (42%)
zf-H2C2_2 426..449 CDD:290200 11/22 (50%)
zf-C2H2 439..461 CDD:278523 12/49 (24%)
C2H2 Zn finger 441..461 CDD:275368 11/47 (23%)
zf-C2H2 467..489 CDD:278523 11/21 (52%)
C2H2 Zn finger 469..489 CDD:275368 11/19 (58%)
C2H2 Zn finger 497..515 CDD:275368 7/17 (41%)
ZNF81NP_001365081.1 KRAB 21..81 CDD:214630
C2H2 Zn finger 249..268 CDD:275368
C2H2 Zn finger 276..296 CDD:275368
C2H2 Zn finger 307..324 CDD:275368
C2H2 Zn finger 332..352 CDD:275368 0/3 (0%)
COG5048 356..>651 CDD:227381 102/277 (37%)
C2H2 Zn finger 360..380 CDD:275368 2/19 (11%)
C2H2 Zn finger 388..408 CDD:275368 6/19 (32%)
C2H2 Zn finger 416..436 CDD:275368 7/19 (37%)
C2H2 Zn finger 444..464 CDD:275368 7/19 (37%)
C2H2 Zn finger 472..492 CDD:275368 8/19 (42%)
C2H2 Zn finger 500..520 CDD:275368 8/19 (42%)
C2H2 Zn finger 528..548 CDD:275368 9/19 (47%)
C2H2 Zn finger 556..576 CDD:275368 2/19 (11%)
C2H2 Zn finger 584..604 CDD:275368 11/19 (58%)
C2H2 Zn finger 612..632 CDD:275368 8/19 (42%)
C2H2 Zn finger 640..660 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.