DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and CG12299

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_609448.1 Gene:CG12299 / 34483 FlyBaseID:FBgn0032295 Length:736 Species:Drosophila melanogaster


Alignment Length:556 Identity:134/556 - (24%)
Similarity:208/556 - (37%) Gaps:180/556 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 QTHQH----------QQHLPNQQKRFFAPYVINGSVPPPPPLQQQQQPLIRTKSTACTRPD---- 186
            |::.|          |.||..||             .|.||.||.|||         ..||    
  Fly     7 QSYHHLPLTITPILQQTHLLPQQ-------------APNPPQQQPQQP---------QPPDLTFH 49

  Fly   187 CPECLDY-------YQRLQT--------GGYKQTAP---------LISP---------------- 211
            |..|.::       ||.:.|        |..:|.:|         :..|                
  Fly    50 CMCCAEFFVHPLALYQHMNTLHPHEPGNGQQEQESPGDESEDYSWIFEPVCELAEDGSDSSDGSA 114

  Fly   212 --------------------AASSVSSSTG---------------------SIRPVRDLI----- 230
                                ::||.|||:.                     |::|:..|:     
  Fly   115 SSGSDSSSSSDDDDDDDDDDSSSSSSSSSNSSSSSSSVPTTSNSNTQQSQESVQPLHGLVAGPGY 179

  Fly   231 ----MSATGGAASTNISLT--TVTNLSLNSVQATAVGMMPKMTGGLITTAVGSNSGAIGGIGG-- 287
                :..|....||:|.:.  ||:...|..:...|..:.|.:  ||.:|.:....|....||.  
  Fly   180 NEFQLQMTDPRESTSIFMVQPTVSVTPLQQLLPPAPTVSPGL--GLQSTPIKRRRGRRSNIGAPV 242

  Fly   288 -YNATSAEEISYKCRICEKVFGCSETLQAHEKTHKSPR-YECADCGKGFSQLRNYKYHLSVHRGT 350
             ..|.:..:..::|..||..|..:..|..|.::|.:.: ::|:.|.|.|:.:.:...|:.:|.|.
  Fly   243 MDPALNGNQKCFQCTHCEASFPNAGDLSKHVRSHITNKPFQCSICQKTFTHIGSLNTHIRIHSGE 307

  Fly   351 KEFAAECPECGKTFNDKGYLSSHLKIHRNRKEYE-----------------------------CP 386
            |.:  :|..|.|.|.....|..|::.|..||.::                             ||
  Fly   308 KPY--KCELCPKAFTQSSSLMVHMRSHSVRKPHQCVQCDKGFINYSSLLLHQKTHIAPTETFICP 370

  Fly   387 YCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRFSRKMLLKQHMRTHSGEKPYQCSVCGKSFADR 451
            .|.:.|......:.|:|:||....::|..|.:.|.....|.|||:.|.||||:.||:|.:||...
  Fly   371 ECEREFKAEALLDEHMRMHTQELVYQCAICREAFRASSELVQHMKNHMGEKPFTCSLCDRSFTQS 435

  Fly   452 SNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTHLNYHTGCKPYVCPHPNCNQAFTQSSNMRTHA 516
            .::.:|.|:|:|.|||.|.||.|.||:...|..|:..|.|.|||.|  |.|.::::|.:.:..|.
  Fly   436 GSLNIHMRIHTGEKPFQCKLCDKCFTQASSLSVHMKIHAGEKPYPC--PICGKSYSQQAYLNKHI 498

  Fly   517 KKCQYRPLDGLTVTSSALPVPG----KQQTGPPPTL 548
            :..|      :...:||...||    ||   |..||
  Fly   499 QAHQ------MASAASASTSPGLLVAKQ---PHETL 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 6/19 (32%)
COG5048 <316..502 CDD:227381 66/215 (31%)
C2H2 Zn finger 327..347 CDD:275368 5/19 (26%)
zf-C2H2 356..377 CDD:278523 6/20 (30%)
C2H2 Zn finger 357..377 CDD:275368 6/19 (32%)
zf-H2C2_2 369..394 CDD:290200 9/53 (17%)
C2H2 Zn finger 385..405 CDD:275368 6/19 (32%)
zf-H2C2_2 397..422 CDD:290200 7/24 (29%)
C2H2 Zn finger 413..433 CDD:275368 7/19 (37%)
zf-H2C2_2 426..449 CDD:290200 13/22 (59%)
zf-C2H2 439..461 CDD:278523 7/21 (33%)
C2H2 Zn finger 441..461 CDD:275368 7/19 (37%)
zf-C2H2 467..489 CDD:278523 9/21 (43%)
C2H2 Zn finger 469..489 CDD:275368 8/19 (42%)
C2H2 Zn finger 497..515 CDD:275368 4/17 (24%)
CG12299NP_609448.1 COG5048 <254..413 CDD:227381 36/160 (23%)
C2H2 Zn finger 256..276 CDD:275368 6/19 (32%)
zf-H2C2_2 268..293 CDD:290200 7/24 (29%)
C2H2 Zn finger 284..304 CDD:275368 5/19 (26%)
zf-H2C2_2 296..321 CDD:290200 8/26 (31%)
zf-C2H2_2 312..>387 CDD:289522 14/74 (19%)
C2H2 Zn finger 312..332 CDD:275368 6/19 (32%)
C2H2 Zn finger 340..360 CDD:275368 0/19 (0%)
C2H2 Zn finger 369..389 CDD:275368 6/19 (32%)
C2H2 Zn finger 397..417 CDD:275368 7/19 (37%)
zf-H2C2_2 409..434 CDD:290200 14/24 (58%)
C2H2 Zn finger 425..445 CDD:275368 7/19 (37%)
zf-H2C2_2 437..462 CDD:290200 12/24 (50%)
C2H2 Zn finger 453..473 CDD:275368 8/19 (42%)
zf-H2C2_2 465..490 CDD:290200 10/26 (38%)
C2H2 Zn finger 481..501 CDD:275368 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.