DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and CG31441

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_731558.1 Gene:CG31441 / 326139 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster


Alignment Length:187 Identity:53/187 - (28%)
Similarity:78/187 - (41%) Gaps:27/187 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 EKVFGCSETLQAHEKTHKSPRYECADCGKGFSQLRNYKYHLSVHRGTKEFAAE--CPECGKTFND 366
            |:|..|.|.|           :..:...||.|        ..|.:.||..:..  |.:||..|..
  Fly   161 EEVEHCQEQL-----------HNMSIISKGVS--------ARVPKRTKRNSKSWFCDQCGGVFKS 206

  Fly   367 KGYLSSHLKIHRNRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRF---SRKMLLKQ 428
            ..||..||:.|...|.:.|..|...:........|..:||..:|:.|..|.|.:   |.|::   
  Fly   207 STYLKLHLQRHSGHKPFACDICQAKYYTDNEMRRHRILHTDARPYACRFCSKTYRGCSSKVV--- 268

  Fly   429 HMRTHSGEKPYQCSVCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTH 485
            |.|||:.|:|:||..|.|:|...|....|..||:..:.:.|.:|.:.|.:..||..|
  Fly   269 HERTHTNERPFQCQHCDKAFTSTSTRQKHEMLHTNQRKYHCEICDQWFLRSSHLTLH 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 5/15 (33%)
COG5048 <316..502 CDD:227381 48/175 (27%)
C2H2 Zn finger 327..347 CDD:275368 3/19 (16%)
zf-C2H2 356..377 CDD:278523 8/22 (36%)
C2H2 Zn finger 357..377 CDD:275368 8/19 (42%)
zf-H2C2_2 369..394 CDD:290200 8/24 (33%)
C2H2 Zn finger 385..405 CDD:275368 3/19 (16%)
zf-H2C2_2 397..422 CDD:290200 7/27 (26%)
C2H2 Zn finger 413..433 CDD:275368 7/22 (32%)
zf-H2C2_2 426..449 CDD:290200 10/22 (45%)
zf-C2H2 439..461 CDD:278523 7/21 (33%)
C2H2 Zn finger 441..461 CDD:275368 6/19 (32%)
zf-C2H2 467..489 CDD:278523 6/19 (32%)
C2H2 Zn finger 469..489 CDD:275368 6/17 (35%)
C2H2 Zn finger 497..515 CDD:275368
CG31441NP_731558.1 zf-AD 7..82 CDD:285071
COG5048 <174..337 CDD:227381 48/163 (29%)
C2H2 Zn finger 197..217 CDD:275370 8/19 (42%)
C2H2 Zn finger 225..245 CDD:275368 3/19 (16%)
C2H2 Zn finger 253..273 CDD:275368 7/22 (32%)
zf-H2C2_2 268..290 CDD:290200 11/24 (46%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
C2H2 Zn finger 309..328 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457847
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.