DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and CG2202

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_572657.2 Gene:CG2202 / 32014 FlyBaseID:FBgn0030240 Length:889 Species:Drosophila melanogaster


Alignment Length:345 Identity:105/345 - (30%)
Similarity:157/345 - (45%) Gaps:63/345 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 EEISYKCRICEKVFGCSETLQAH-EKTHKSPRYECADCGKGFSQLRNYKYH-LSVHRG------- 349
            |:..:.|..|.|.|..|:.|:|| :..|.:..::|:.|...||:|...:.| :|.|.|       
  Fly   498 EKKPHNCPHCPKAFARSDHLKAHVQSLHSNKEHKCSLCEAAFSRLDALERHKVSKHNGEGLEPGS 562

  Fly   350 --------------TKEFAAE----------------CPECGKTFNDKGYLSSHLKIHRNRKEYE 384
                          :|.|:::                |..|.:||.::..|..|.|.|..::.:.
  Fly   563 ELKLQLAEHTCEYCSKRFSSKTYLRKHTLLHTDFLYACKTCDETFRERAQLREHEKTHTGQRNFL 627

  Fly   385 CPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRFSRKMLLKQHMRTHSGEKPYQCSVCGKSFA 449
            |..|..||.:.....:|:|.|.|.||:||..|.|.|.|...||.|.|.|:|.||..|:.|||||.
  Fly   628 CCICGDSFARNDYLRVHMRRHNGEKPYKCRFCVKAFPRATDLKVHERYHTGTKPNLCNTCGKSFH 692

  Fly   450 DRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTHLNYHTGCKPYVCPHPNCNQAFTQSSNMRT 514
            ...|:|:|.|.|:|.:|:.|..|||:||:.:.||.|:..||| :.|.|||  |:..|.|..|||.
  Fly   693 RAYNLTIHMRTHTGERPYKCDQCPKSFTQSNDLKAHIRRHTG-ERYKCPH--CDAYFLQLYNMRN 754

  Fly   515 HAKKCQYRPLDGLTVTSSALPVPGK-QQTGPPPTLAMAMAQTFQMPPP--PGVLTP--------- 567
            |......:.::..|         |: |:||.......:...|..|||.  |..|.|         
  Fly   755 HCMSAHNKHIETKT---------GRLQRTGLLDDGGQSHLTTVVMPPARYPNELDPQLAATAAAT 810

  Fly   568 GSGPSQPPSQQTLLSNLRTF 587
            .:|.::..|..|::.:..|:
  Fly   811 AAGGAESTSSTTVIHSPGTY 830

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 8/20 (40%)
COG5048 <316..502 CDD:227381 74/224 (33%)
C2H2 Zn finger 327..347 CDD:275368 7/20 (35%)
zf-C2H2 356..377 CDD:278523 7/36 (19%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
zf-H2C2_2 369..394 CDD:290200 8/24 (33%)
C2H2 Zn finger 385..405 CDD:275368 6/19 (32%)
zf-H2C2_2 397..422 CDD:290200 11/24 (46%)
C2H2 Zn finger 413..433 CDD:275368 9/19 (47%)
zf-H2C2_2 426..449 CDD:290200 13/22 (59%)
zf-C2H2 439..461 CDD:278523 10/21 (48%)
C2H2 Zn finger 441..461 CDD:275368 10/19 (53%)
zf-C2H2 467..489 CDD:278523 9/21 (43%)
C2H2 Zn finger 469..489 CDD:275368 9/19 (47%)
C2H2 Zn finger 497..515 CDD:275368 9/17 (53%)
CG2202NP_572657.2 zf-AD 45..121 CDD:285071
C2H2 Zn finger 150..171 CDD:275368
C2H2 Zn finger 192..213 CDD:275370
C2H2 Zn finger 221..239 CDD:275370
COG5048 <443..730 CDD:227381 75/231 (32%)
C2H2 Zn finger 476..496 CDD:275368
zf-H2C2_2 488..513 CDD:290200 5/14 (36%)
C2H2 Zn finger 504..525 CDD:275368 8/20 (40%)
C2H2 Zn finger 532..548 CDD:275368 5/15 (33%)
C2H2 Zn finger 573..593 CDD:275368 2/19 (11%)
C2H2 Zn finger 600..620 CDD:275368 7/19 (37%)
zf-H2C2_2 613..637 CDD:290200 8/23 (35%)
C2H2 Zn finger 628..648 CDD:275368 6/19 (32%)
zf-H2C2_2 640..663 CDD:290200 10/22 (45%)
C2H2 Zn finger 656..676 CDD:275368 9/19 (47%)
C2H2 Zn finger 684..704 CDD:275368 10/19 (53%)
zf-C2H2 684..704 CDD:278523 10/19 (53%)
zf-H2C2_2 696..721 CDD:290200 12/24 (50%)
C2H2 Zn finger 712..732 CDD:275368 9/19 (47%)
C2H2 Zn finger 739..755 CDD:275368 9/17 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457846
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.