DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and Zfp667

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001008557.1 Gene:Zfp667 / 308326 RGDID:1359114 Length:608 Species:Rattus norvegicus


Alignment Length:223 Identity:91/223 - (40%)
Similarity:130/223 - (58%) Gaps:6/223 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 EISYKCRICEKVFGCSETLQAHEKTHKSPR--YECADCGKGFSQLRNYKYHLSVHRGTKEFAAEC 357
            |..:||..||||.....:...|:|.||..:  .||.:|||.|..::|.|.||::|...|.|  :|
  Rat   381 EKQFKCNKCEKVCNRLSSFIQHKKIHKRKKKLIECKECGKMFGGMKNLKVHLNIHSEEKPF--KC 443

  Fly   358 PECGKTFNDKGYLSSHLKIHRNRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRFSR 422
            .:|.|.|..:.:||.|.:||...|.|:|..|.|:|:.|::...|.|||:..:|::|:.|||.||:
  Rat   444 NKCSKVFGRQSFLSEHQRIHTGEKPYQCEECGKAFSHRISLTRHKRIHSEDRPYECDLCGKAFSQ 508

  Fly   423 KMLLKQHMRTHSGEKPYQCSVCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTHLN 487
            ...|.||.|.|:|||||.|.:|.|||..|.::.||.|.|:|.||:.|..|.|||:....|..|..
  Rat   509 SAHLAQHERIHTGEKPYACKICKKSFTQRISLILHERSHTGEKPYECNECGKAFSSGSDLIRHQR 573

  Fly   488 YHTGCKPYVCPHPNCNQAFTQSSNMRTH 515
            .|:..|||.|  ..|.:|:::||::..|
  Rat   574 SHSSEKPYEC--SKCGKAYSRSSSLIRH 599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 7/19 (37%)
COG5048 <316..502 CDD:227381 79/187 (42%)
C2H2 Zn finger 327..347 CDD:275368 9/19 (47%)
zf-C2H2 356..377 CDD:278523 7/20 (35%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
zf-H2C2_2 369..394 CDD:290200 11/24 (46%)
C2H2 Zn finger 385..405 CDD:275368 7/19 (37%)
zf-H2C2_2 397..422 CDD:290200 10/24 (42%)
C2H2 Zn finger 413..433 CDD:275368 10/19 (53%)
zf-H2C2_2 426..449 CDD:290200 14/22 (64%)
zf-C2H2 439..461 CDD:278523 10/21 (48%)
C2H2 Zn finger 441..461 CDD:275368 9/19 (47%)
zf-C2H2 467..489 CDD:278523 7/21 (33%)
C2H2 Zn finger 469..489 CDD:275368 7/19 (37%)
C2H2 Zn finger 497..515 CDD:275368 5/17 (29%)
Zfp667NP_001008557.1 KRAB 14..74 CDD:214630
KRAB 14..53 CDD:279668
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..143
COG5048 141..599 CDD:227381 90/221 (41%)
C2H2 Zn finger 146..166 CDD:275368
C2H2 Zn finger 174..194 CDD:275368
C2H2 Zn finger 202..222 CDD:275368
C2H2 Zn finger 255..275 CDD:275368
C2H2 Zn finger 283..301 CDD:275368
C2H2 Zn finger 330..350 CDD:275368
C2H2 Zn finger 358..378 CDD:275368
C2H2 Zn finger 415..435 CDD:275368 9/19 (47%)
zf-H2C2_2 427..452 CDD:290200 11/26 (42%)
C2H2 Zn finger 443..463 CDD:275368 7/19 (37%)
zf-H2C2_2 456..480 CDD:290200 11/23 (48%)
C2H2 Zn finger 471..491 CDD:275368 7/19 (37%)
zf-H2C2_2 483..508 CDD:290200 10/24 (42%)
C2H2 Zn finger 499..519 CDD:275368 10/19 (53%)
zf-H2C2_2 511..536 CDD:290200 15/24 (63%)
C2H2 Zn finger 527..547 CDD:275368 9/19 (47%)
zf-H2C2_2 539..564 CDD:290200 12/24 (50%)
C2H2 Zn finger 555..575 CDD:275368 7/19 (37%)
zf-H2C2_2 567..592 CDD:290200 9/26 (35%)
C2H2 Zn finger 583..603 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.