DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and Zfp93

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001100016.1 Gene:Zfp93 / 296399 RGDID:1309760 Length:427 Species:Rattus norvegicus


Alignment Length:184 Identity:66/184 - (35%)
Similarity:97/184 - (52%) Gaps:8/184 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 GTKEFAAECPECG-KTFNDKGYLSSHLKIHRNRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHK 412
            |.:.|....|.|. ||.:....|..||:||...|.::|.:|.|.|:::....||:|.||.|||||
  Rat    77 GERTFNCCYPGCHFKTVHGMKDLDRHLRIHTGDKPHKCEFCDKCFSRKDNLTMHMRCHTSVKPHK 141

  Fly   413 CNECGKRFSRKMLLKQHMRTHSGEKPYQCSVCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFT 477
            |:.|.........||:|:|.||.|:||:|.:|..:..:.|.:|:|.|.|:|..||.|.||...|.
  Rat   142 CHLCDYAAVDSSSLKKHLRIHSDERPYKCQMCPYASRNSSQLTVHLRSHTGDTPFQCWLCSAKFK 206

  Fly   478 KKHHLKTHLNYHTGCKPYVCPHPNCNQAFTQSSNMRTHAK-----KCQYRPLDG 526
            ....||.|:..|:|.||:.|..  |:...|..:|:::|.:     ||.:....|
  Rat   207 ISSDLKRHMIVHSGEKPFKCEF--CDVRCTMKANLKSHIRIKHTFKCLHCAFQG 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368
COG5048 <316..502 CDD:227381 59/153 (39%)
C2H2 Zn finger 327..347 CDD:275368
zf-C2H2 356..377 CDD:278523 7/21 (33%)
C2H2 Zn finger 357..377 CDD:275368 7/20 (35%)
zf-H2C2_2 369..394 CDD:290200 10/24 (42%)
C2H2 Zn finger 385..405 CDD:275368 7/19 (37%)
zf-H2C2_2 397..422 CDD:290200 12/24 (50%)
C2H2 Zn finger 413..433 CDD:275368 6/19 (32%)
zf-H2C2_2 426..449 CDD:290200 11/22 (50%)
zf-C2H2 439..461 CDD:278523 7/21 (33%)
C2H2 Zn finger 441..461 CDD:275368 6/19 (32%)
zf-C2H2 467..489 CDD:278523 8/21 (38%)
C2H2 Zn finger 469..489 CDD:275368 7/19 (37%)
C2H2 Zn finger 497..515 CDD:275368 4/17 (24%)
Zfp93NP_001100016.1 COG5048 <96..227 CDD:227381 52/130 (40%)
zf-H2C2_2 98..123 CDD:290200 10/24 (42%)
C2H2 Zn finger 114..134 CDD:275368 7/19 (37%)
C2H2 Zn finger 142..162 CDD:275368 6/19 (32%)
C2H2 Zn finger 170..190 CDD:275368 6/19 (32%)
C2H2 Zn finger 198..218 CDD:275368 7/19 (37%)
zf-H2C2_2 210..234 CDD:290200 9/25 (36%)
C2H2 Zn finger 226..245 CDD:275368 5/20 (25%)
C2H2 Zn finger 279..299 CDD:275368
C2H2 Zn finger 307..328 CDD:275368
C2H2 Zn finger 364..384 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.