DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and ZNF324

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_005258770.1 Gene:ZNF324 / 25799 HGNCID:14096 Length:558 Species:Homo sapiens


Alignment Length:555 Identity:149/555 - (26%)
Similarity:229/555 - (41%) Gaps:139/555 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 AAAAAAGLSTPPTSPYQTHQHQQHLPNQQKRFFAPYVINGSVPPPPPLQQQQQPLIRTKSTACTR 184
            |..|:.||||          .:..:..|.:|...|:|.:|:          ...|.||.      
Human    40 ALVASLGLST----------SRPRVVIQLERGEEPWVPSGT----------DTTLSRTT------ 78

  Fly   185 PDCPECLDYYQRLQTG----------------GYKQTAPLISPAASSVSSSTGSIR--------- 224
                     |:|...|                .:..|.|.::.:...|:.:..|::         
Human    79 ---------YRRRNPGSWSLTEDRDVSGEWPRAFPDTPPGMTTSVFPVAGACHSVKSLQRQRGAS 134

  Fly   225 PVRD-------------LIMSATGGAASTNISLT--------------TVTNLSL-------NSV 255
            |.|:             |::.:..|.||.::.||              |:|..:|       ...
Human   135 PSRERKPTGVSVIYWERLLLGSGSGQASVSLRLTSPLRPPEGVRLREKTLTEHALLGRQPRTPER 199

  Fly   256 QATAVGMMPKMTGGL---ITTAVGSNSGAIGGI--------GGYNATSAEEI---------SYKC 300
            |......:|..|.|.   :..|.|.....:|.:        ||...::.:|:         |::|
Human   200 QKPCAQEVPGRTFGSAQDLEAAGGRGHHRMGAVWQEPHRLLGGQEPSTWDELGEALHAGEKSFEC 264

  Fly   301 RICEKVFGCSETLQAHEKTHKSPR-YECADCGKGFSQLRNYKYHLSVHRGTKEFAAECPECGKTF 364
            |.|.|||..|..|..|.:||...| ||||.|||.|||..:...|..:|.|...:|  ||.|||.|
Human   265 RACSKVFVKSSDLLKHLRTHTGERPYECAQCGKAFSQTSHLTQHQRIHSGETPYA--CPVCGKAF 327

  Fly   365 NDKGYLSSHLKIHRNRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRFSRKMLLKQH 429
            .....|..|.:||...|.:.|..|.|:|:.....:.|.:||.|.:|:.|.:||:||.|...|.||
Human   328 RHSSSLVRHQRIHTAEKSFRCSECGKAFSHGSNLSQHRKIHAGGRPYACAQCGRRFCRNSHLIQH 392

  Fly   430 MRTHSGEKPYQCSVCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTHLNYHTGCKP 494
            .|||:||||:.|::||.:|:..|::..|.|:|:|.|||:||.|.:||:...:|..|...|||.:|
Human   393 ERTHTGEKPFVCALCGAAFSQGSSLFKHQRVHTGEKPFACPQCGRAFSHSSNLTQHQLLHTGERP 457

  Fly   495 YVCPHPNCNQAFTQSSNMRTHAK-----------KC--QYRPLDGL----TVTSSALPVPGKQQT 542
            :.|  .:|.:||.:.:.:.:|.:           :|  .:|....|    .:.:....|...:.:
Human   458 FRC--VDCGKAFAKGAVLLSHRRIHTGEKPFVCTQCGRAFRERPALFHHQRIHTGEKTVRRSRAS 520

  Fly   543 GPPPTLAMAMAQTFQMPPPPGVLTPGSGP---SQP 574
            ..|...::|.|.:...|......||.|||   |||
Human   521 LHPQARSVAGASSEGAPAKETEPTPASGPAAVSQP 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 9/19 (47%)
COG5048 <316..502 CDD:227381 78/186 (42%)
C2H2 Zn finger 327..347 CDD:275368 9/19 (47%)
zf-C2H2 356..377 CDD:278523 8/20 (40%)
C2H2 Zn finger 357..377 CDD:275368 8/19 (42%)
zf-H2C2_2 369..394 CDD:290200 9/24 (38%)
C2H2 Zn finger 385..405 CDD:275368 5/19 (26%)
zf-H2C2_2 397..422 CDD:290200 10/24 (42%)
C2H2 Zn finger 413..433 CDD:275368 10/19 (53%)
zf-H2C2_2 426..449 CDD:290200 13/22 (59%)
zf-C2H2 439..461 CDD:278523 7/21 (33%)
C2H2 Zn finger 441..461 CDD:275368 7/19 (37%)
zf-C2H2 467..489 CDD:278523 8/21 (38%)
C2H2 Zn finger 469..489 CDD:275368 7/19 (37%)
C2H2 Zn finger 497..515 CDD:275368 4/17 (24%)
ZNF324XP_005258770.1 KRAB 6..66 CDD:214630 9/35 (26%)
KRAB 6..45 CDD:279668 2/4 (50%)
C2H2 Zn finger 264..284 CDD:275368 9/19 (47%)
COG5048 <268..468 CDD:227381 85/203 (42%)
zf-H2C2_2 276..301 CDD:290200 13/24 (54%)
C2H2 Zn finger 292..312 CDD:275368 9/19 (47%)
zf-H2C2_2 304..329 CDD:290200 10/26 (38%)
C2H2 Zn finger 320..340 CDD:275368 8/19 (42%)
zf-H2C2_2 332..357 CDD:290200 9/24 (38%)
C2H2 Zn finger 348..368 CDD:275368 5/19 (26%)
zf-C2H2 374..396 CDD:278523 10/21 (48%)
C2H2 Zn finger 376..396 CDD:275368 10/19 (53%)
zf-H2C2_2 388..413 CDD:290200 14/24 (58%)
C2H2 Zn finger 404..424 CDD:275368 7/19 (37%)
zf-H2C2_2 416..441 CDD:290200 12/24 (50%)
C2H2 Zn finger 432..452 CDD:275368 7/19 (37%)
COG5048 437..>524 CDD:227381 17/88 (19%)
zf-H2C2_2 444..468 CDD:290200 9/25 (36%)
C2H2 Zn finger 460..480 CDD:275368 5/21 (24%)
zf-H2C2_2 473..495 CDD:290200 2/21 (10%)
C2H2 Zn finger 488..508 CDD:275368 3/19 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.