DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and ZNF718

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001034216.2 Gene:ZNF718 / 255403 HGNCID:26889 Length:478 Species:Homo sapiens


Alignment Length:294 Identity:107/294 - (36%)
Similarity:140/294 - (47%) Gaps:59/294 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 EISYKCRICEKVFGCSETLQAHEKTHKSPR-YECADCGKGFSQLRNYKYHLSVHRGTKEFAAECP 358
            |..|.|..|.|.|..|..|..|::.|...: |:|.:|||||::..:...|..:|.|.|.:.  |.
Human   196 ENPYTCEECGKAFNWSSILTKHKRIHAREKFYKCEECGKGFTRSSHLTKHKRIHTGEKPYI--CE 258

  Fly   359 ECGKTFNDKGYLSSHLKIHRNRKEYECPYCPKSF--------NQRV------------------- 396
            :|||.||....|:.|.:||..:|.|:|..|.|:|        ::|:                   
Human   259 KCGKAFNQSSTLNLHKRIHSAQKYYKCEECGKAFKWSSSLNEHKRIHAGEKPFSCEECGNVFTTS 323

  Fly   397 -AFNMHVRIHTGVKPHKCNECGKRFSRKMLLKQHMRTHSGEKPYQCSVCGKSFADRSNMTLHHRL 460
             .|..|.|||||.||:||.||||.|:|...|..|.|.|:|||||.|..|||:|...|.:.:|.|:
Human   324 SDFAKHKRIHTGEKPYKCEECGKSFNRSTTLTTHKRIHTGEKPYTCEECGKAFNWSSTLNVHKRI 388

  Fly   461 HSGIKPFSCPLCPKAFTKKHHLKTHLNYHTGCKPYVCPHPNCNQAFTQSSNMRTHAK-------- 517
            |||..|:.|..|.|||....:|..|...|||.|||:|  ..|.:||.|||::..|.|        
Human   389 HSGKNPYKCEDCGKAFKVFANLHNHKKIHTGEKPYIC--KQCGKAFKQSSHLNKHKKIHTVDKPY 451

  Fly   518 KC--------QYRPLDGLTVTSSALPVPGKQQTG 543
            ||        ||          |.||...:..||
Human   452 KCKECGKAFKQY----------SNLPQHKRTHTG 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 7/19 (37%)
COG5048 <316..502 CDD:227381 82/214 (38%)
C2H2 Zn finger 327..347 CDD:275368 7/19 (37%)
zf-C2H2 356..377 CDD:278523 8/20 (40%)
C2H2 Zn finger 357..377 CDD:275368 8/19 (42%)
zf-H2C2_2 369..394 CDD:290200 10/32 (31%)
C2H2 Zn finger 385..405 CDD:275368 8/47 (17%)
zf-H2C2_2 397..422 CDD:290200 16/24 (67%)
C2H2 Zn finger 413..433 CDD:275368 10/19 (53%)
zf-H2C2_2 426..449 CDD:290200 13/22 (59%)
zf-C2H2 439..461 CDD:278523 9/21 (43%)
C2H2 Zn finger 441..461 CDD:275368 8/19 (42%)
zf-C2H2 467..489 CDD:278523 7/21 (33%)
C2H2 Zn finger 469..489 CDD:275368 7/19 (37%)
C2H2 Zn finger 497..515 CDD:275368 7/17 (41%)
ZNF718NP_001034216.2 KRAB 4..64 CDD:214630
C2H2 Zn finger 146..165 CDD:275368
C2H2 Zn finger 173..193 CDD:275368
C2H2 Zn finger 201..221 CDD:275368 7/19 (37%)
COG5048 <225..386 CDD:227381 60/162 (37%)
C2H2 Zn finger 229..249 CDD:275368 7/19 (37%)
C2H2 Zn finger 257..277 CDD:275368 8/19 (42%)
C2H2 Zn finger 285..305 CDD:275368 5/19 (26%)
C2H2 Zn finger 313..333 CDD:275368 3/19 (16%)
COG5048 <322..474 CDD:227381 67/163 (41%)
C2H2 Zn finger 341..361 CDD:275368 10/19 (53%)
C2H2 Zn finger 369..389 CDD:275368 8/19 (42%)
C2H2 Zn finger 397..417 CDD:275368 7/19 (37%)
C2H2 Zn finger 425..445 CDD:275368 9/21 (43%)
C2H2 Zn finger 453..473 CDD:275368 6/29 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24384
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.