DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and POGZ

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_016856233.1 Gene:POGZ / 23126 HGNCID:18801 Length:1417 Species:Homo sapiens


Alignment Length:615 Identity:138/615 - (22%)
Similarity:198/615 - (32%) Gaps:190/615 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 PDLVAMANATKF------YAQFFPHLLPAYAAAAAAAGLSTPPTSPYQTHQHQQHLPNQQKRFFA 153
            |..:..|..|:|      ..|.|..:.|....       ||.|..| .|:.....:|       |
Human   191 PITLVPAPGTQFVKPTVGVPQVFSQMTPVRPG-------STMPVRP-TTNTFTTVIP-------A 240

  Fly   154 PYVINGSVPPPPPLQQQQQPLIRTKSTACTRPDCPECLDYY---QRLQTGGYKQTAPLISPAASS 215
            ...|..:||.....|.:..|...|..|| |:|.....|...   |..||...|......||.|.|
Human   241 TLTIRSTVPQSQSQQTKSTPSTSTTPTA-TQPTSLGQLAVQSPGQSNQTTNPKLAPSFPSPPAVS 304

  Fly   216 VSSSTGSIRPVRDLIMSATGGAASTNISLTTVTNLSLNSVQATAVGMMPKMTGGLITTAVGSNSG 280
            ::|.....||         |.....:..:..:.| :||::  .::|..|   |.::   |.:||.
Human   305 IASFVTVKRP---------GVTGENSNEVAKLVN-TLNTI--PSLGQSP---GPVV---VSNNSS 351

  Fly   281 AIGGIGGYNATSAEEISYK-----------------CRICEKVFGCSETLQAH------------ 316
            |.|.    ..||..|.|.|                 |..|...|..:|.|:.|            
Human   352 AHGS----QRTSGPESSMKVTSSIPVFDLQDGGRKICPRCNAQFRVTEALRGHMCYCCPEMVEYQ 412

  Fly   317 ---------------------EKT------------------HKSPR------------------ 324
                                 |||                  .|.|.                  
Human   413 KKGKSLDSEPSVPSAAKPPSPEKTAPVASTPSSTPIPALSPPTKVPEPNENVGDAVQTKLIMLVD 477

  Fly   325 --YECADCGKGFSQLRNYKYHLSVHRGTKEFAAECPECGKTFNDK----GYLSSHLKIHRNRKEY 383
              |...|.|| .:||.|:....:..|        ||.|.|...:.    .::..|:::.:...|.
Human   478 DFYYGRDGGK-VAQLTNFPKVATSFR--------CPHCTKRLKNNIRFMNHMKHHVELDQQNGEV 533

  Fly   384 E----CPYCPKSFNQRVAFNMHV-RIHTGVKPH----KCNECGKRFSRKMLLKQHMR-THS-GEK 437
            :    |.:|.:.|:.......|: .:|:   |:    ||..|...|..:.|..|||: ||. ||.
Human   534 DGHTICQHCYRQFSTPFQLQCHLENVHS---PYESTTKCKICEWAFESEPLFLQHMKDTHKPGEM 595

  Fly   438 PYQCSVCGKSFADRSNMTLHHR-LHSGIKPFSCPLCPKAFTKKHHLKTHLNYHTGCKPYVCPHPN 501
            ||.|.||....:..|.:.:|.| :|...:...||.|.|.|...:..:.|...|.....|.|  ..
Human   596 PYVCQVCQYRSSLYSEVDVHFRMIHEDTRHLLCPYCLKVFKNGNAFQQHYMRHQKRNVYHC--NK 658

  Fly   502 CNQAFTQSSNMRTHAKKCQY-------RPLDGL------TVTSS---ALPVPGKQQTGPPPTLAM 550
            |...|..:.:...|  |.|:       :.|:||      |:.:|   ...||......||..|..
Human   659 CRLQFLFAKDKIEH--KLQHHKTFRKPKQLEGLKPGTKVTIRASRGQPRTVPVSSNDTPPSALQE 721

  Fly   551 AMAQTFQMPPPPGVLTPGSGPSQPPSQQTL 580
            |...|..|.|.|..|       .||.|:::
Human   722 AAPLTSSMDPLPVFL-------YPPVQRSI 744

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 9/70 (13%)
COG5048 <316..502 CDD:227381 56/272 (21%)
C2H2 Zn finger 327..347 CDD:275368 6/19 (32%)
zf-C2H2 356..377 CDD:278523 5/24 (21%)
C2H2 Zn finger 357..377 CDD:275368 5/23 (22%)
zf-H2C2_2 369..394 CDD:290200 5/28 (18%)
C2H2 Zn finger 385..405 CDD:275368 4/20 (20%)
zf-H2C2_2 397..422 CDD:290200 7/29 (24%)
C2H2 Zn finger 413..433 CDD:275368 7/20 (35%)
zf-H2C2_2 426..449 CDD:290200 12/24 (50%)
zf-C2H2 439..461 CDD:278523 7/22 (32%)
C2H2 Zn finger 441..461 CDD:275368 6/20 (30%)
zf-C2H2 467..489 CDD:278523 6/21 (29%)
C2H2 Zn finger 469..489 CDD:275368 6/19 (32%)
C2H2 Zn finger 497..515 CDD:275368 3/17 (18%)
POGZXP_016856233.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.