DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and ZNF652

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001138837.1 Gene:ZNF652 / 22834 HGNCID:29147 Length:606 Species:Homo sapiens


Alignment Length:272 Identity:89/272 - (32%)
Similarity:125/272 - (45%) Gaps:12/272 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 CRICEKVFGCSETLQAHEKTHKSPRYECADCGKGFSQLRNYKYHLSVHRGTKEFAAECPECGKTF 364
            |..|.|.|.....|..|::|......:|..|.|.|.:|.:...|:.:..|..|....|..|.|.|
Human   274 CDKCGKKFVLESELSLHQQTDCEKNIQCVSCNKSFKKLWSLHEHIKIVHGYAEKKFSCEICEKKF 338

  Fly   365 NDKGYLSSHLKIHRNRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRFSRKMLLKQH 429
            ....::..|:..|.....:.|..|.|||.:.::..:|...|:|.||.:|..|.:||..|..|:.|
Human   339 YTMAHVRKHMVAHTKDMPFTCETCGKSFKRSMSLKVHSLQHSGEKPFRCENCDERFQYKYQLRSH 403

  Fly   430 MRTHSGEKPYQCSVCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTHLNYHTGCKP 494
            |..|.|.|.:.|..|||.|..:.....|.:.|:|.|||.|.:|.|:||.:.::|.|...|||.||
Human   404 MSIHIGHKQFMCQWCGKDFNMKQYFDEHMKTHTGEKPFICEICGKSFTSRPNMKRHRRTHTGEKP 468

  Fly   495 YVCPHPNCNQAFTQSSNMRTHAKKCQYRPLDGLTV---------TSSALPVPGKQQTGPPPTLAM 550
            |.|  ..|.|.|..|:.::.|.:|| :|....:.|         ||.|.|||....|...||..:
Human   469 YPC--DVCGQRFRFSNMLKAHKEKC-FRVTSPVNVPPAVQIPLTTSPATPVPSVVNTATTPTPPI 530

  Fly   551 AMAQTFQMPPPP 562
            .|.....:||.|
Human   531 NMNPVSTLPPRP 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 6/19 (32%)
COG5048 <316..502 CDD:227381 62/185 (34%)
C2H2 Zn finger 327..347 CDD:275368 6/19 (32%)
zf-C2H2 356..377 CDD:278523 5/20 (25%)
C2H2 Zn finger 357..377 CDD:275368 5/19 (26%)
zf-H2C2_2 369..394 CDD:290200 7/24 (29%)
C2H2 Zn finger 385..405 CDD:275368 6/19 (32%)
zf-H2C2_2 397..422 CDD:290200 9/24 (38%)
C2H2 Zn finger 413..433 CDD:275368 8/19 (42%)
zf-H2C2_2 426..449 CDD:290200 10/22 (45%)
zf-C2H2 439..461 CDD:278523 6/21 (29%)
C2H2 Zn finger 441..461 CDD:275368 6/19 (32%)
zf-C2H2 467..489 CDD:278523 8/21 (38%)
C2H2 Zn finger 469..489 CDD:275368 7/19 (37%)
C2H2 Zn finger 497..515 CDD:275368 5/17 (29%)
ZNF652NP_001138837.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..113
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 130..235
UFD1 <240..304 CDD:332114 8/29 (28%)
C2H2 Zn finger 247..266 CDD:275368
C2H2 Zn finger 274..293 CDD:275368 6/18 (33%)
C2H2 Zn finger 301..321 CDD:275368 6/19 (32%)
C2H2 Zn finger 331..351 CDD:275368 5/19 (26%)
C2H2 Zn finger 359..379 CDD:275368 6/19 (32%)
SFP1 <381..464 CDD:227516 32/82 (39%)
C2H2 Zn finger 387..407 CDD:275368 8/19 (42%)
C2H2 Zn finger 415..435 CDD:275368 6/19 (32%)
COG5048 439..>488 CDD:227381 21/50 (42%)
C2H2 Zn finger 443..463 CDD:275368 7/19 (37%)
C2H2 Zn finger 471..487 CDD:275368 5/17 (29%)
Mediates interaction with CBFA2T3. /evidence=ECO:0000269|PubMed:16966434 498..606 14/45 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.