Sequence 1: | NP_609739.2 | Gene: | CG15269 / 34887 | FlyBaseID: | FBgn0028878 | Length: | 587 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_033564.2 | Gene: | Plagl1 / 22634 | MGIID: | 1100874 | Length: | 704 | Species: | Mus musculus |
Alignment Length: | 284 | Identity: | 73/284 - (25%) |
---|---|---|---|
Similarity: | 115/284 - (40%) | Gaps: | 46/284 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 325 YECADCGKGFSQLRNYKYHLSVHRGTKEFAAECPECGKTFNDKGYLSSHLKIHRNRKEYECPYCP 389
Fly 390 KSFNQRVAFNMHVRIHTGVKPHK----CNECGKRFSRKMLLKQHMRTHSGEK-PYQCSVCGKSFA 449
Fly 450 DRSNMTLHHRLHS--------GIKPFSCPLCPKAFTKKHHLKTHLNYHTGCKPYVCPHPNCNQAF 506
Fly 507 TQSSNMRTHAKKC-------------QYRPLDGLTVTSSAL-----PVPGKQ-----QTG----- 543
Fly 544 PPPTLAMAMAQTFQMPPPPGVLTP 567 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15269 | NP_609739.2 | C2H2 Zn finger | 300..320 | CDD:275368 | |
COG5048 | <316..502 | CDD:227381 | 53/189 (28%) | ||
C2H2 Zn finger | 327..347 | CDD:275368 | 7/19 (37%) | ||
zf-C2H2 | 356..377 | CDD:278523 | 8/20 (40%) | ||
C2H2 Zn finger | 357..377 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 369..394 | CDD:290200 | 8/24 (33%) | ||
C2H2 Zn finger | 385..405 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 397..422 | CDD:290200 | 8/28 (29%) | ||
C2H2 Zn finger | 413..433 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 426..449 | CDD:290200 | 7/23 (30%) | ||
zf-C2H2 | 439..461 | CDD:278523 | 4/21 (19%) | ||
C2H2 Zn finger | 441..461 | CDD:275368 | 4/19 (21%) | ||
zf-C2H2 | 467..489 | CDD:278523 | 5/21 (24%) | ||
C2H2 Zn finger | 469..489 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 497..515 | CDD:275368 | 4/17 (24%) | ||
Plagl1 | NP_033564.2 | C2H2 Zn finger | 6..26 | CDD:275368 | 7/19 (37%) |
C2H2 Zn finger | 34..56 | CDD:275368 | 8/21 (38%) | ||
zf-H2C2_2 | 49..73 | CDD:290200 | 8/23 (35%) | ||
C2H2 Zn finger | 64..84 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 93..113 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 122..142 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 158..178 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 186..207 | CDD:275368 | 7/22 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |