DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and Zfp523

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001344924.1 Gene:Zfp523 / 224656 MGIID:2687278 Length:568 Species:Mus musculus


Alignment Length:357 Identity:108/357 - (30%)
Similarity:161/357 - (45%) Gaps:62/357 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 VGSNSG--AIGGIGGYNATSAEEISYKCRICEKVFGCSETLQAHEK-----THKSP--------- 323
            |.|:|.  |:....|....:||:        |:.|| ::|:.|.|:     .|.||         
Mouse   104 VPSDSAILAVQTEAGLEDLAAED--------EEGFG-TDTVVALEQYASKVLHDSPASHNGKGQQ 159

  Fly   324 ----RYECA--DCGKGFSQLRNYKYHLSVHRGTKEFAAECPECGKTFNDKGY-LSSHLKIHRNRK 381
                .:.|.  .||:.::...:.|.|...|.|.:.:..:.|.|||.| ..|| |.||::.|...|
Mouse   160 VGDRAFRCGYKGCGRLYTTAHHLKVHERAHTGDRPYRCDFPSCGKAF-ATGYGLKSHVRTHTGEK 223

  Fly   382 EYECP--YCPKSFNQRVAFNMHVRIHTGVKPHKC--NECGKRFSRKMLLKQHMRTHSGEKPYQCS 442
            .|:||  .|.|:|........|||.|||.:|.:|  ..||:.|:...:.|.|:|||:||:||.|.
Mouse   224 PYKCPEELCSKAFKTSGDLQKHVRTHTGERPFRCPFEGCGRSFTTSNIRKVHVRTHTGERPYTCP 288

  Fly   443 V--CGKSFADRSNMTLHHRLHSGIKPFSC--PLCPKAFTKKHHLKTHLNYHTGCKPYVCPHPNCN 503
            .  ||:.|...:|...|.|:|:|.||:.|  |.|.|.||:...|..|...||.||||.|  .:|.
Mouse   289 EPHCGRGFTSATNYKNHVRIHTGEKPYVCTVPGCGKRFTEYSSLYKHHVVHTHCKPYTC--SSCG 351

  Fly   504 QAFTQSSNMRTHAKKCQYRPLDGLTVTSSA------LPVPGKQQTGPPPT------LAMAMAQTF 556
            :.:.|:|.:..| |:..:..|:....:..|      |......:..|||.      |:....::.
Mouse   352 KTYRQTSTLAMH-KRSAHGELEATEESEQALYEQQQLEAASAAEESPPPKPTHIAYLSEVKEESS 415

  Fly   557 QMPPPPGVLTPGSGP------SQPPSQQTLLS 582
            .:|....::|...||      :|..:||..||
Mouse   416 AIPTQVAMVTEEDGPPQVALITQDGTQQVSLS 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 6/24 (25%)
COG5048 <316..502 CDD:227381 75/214 (35%)
C2H2 Zn finger 327..347 CDD:275368 5/21 (24%)
zf-C2H2 356..377 CDD:278523 10/21 (48%)
C2H2 Zn finger 357..377 CDD:275368 10/20 (50%)
zf-H2C2_2 369..394 CDD:290200 12/27 (44%)
C2H2 Zn finger 385..405 CDD:275368 8/21 (38%)
zf-H2C2_2 397..422 CDD:290200 11/26 (42%)
C2H2 Zn finger 413..433 CDD:275368 7/21 (33%)
zf-H2C2_2 426..449 CDD:290200 12/24 (50%)
zf-C2H2 439..461 CDD:278523 8/23 (35%)
C2H2 Zn finger 441..461 CDD:275368 7/21 (33%)
zf-C2H2 467..489 CDD:278523 8/23 (35%)
C2H2 Zn finger 469..489 CDD:275368 8/21 (38%)
C2H2 Zn finger 497..515 CDD:275368 4/17 (24%)
Zfp523NP_001344924.1 3 X 12 AA approximate repeats 34..99
C2H2 Zn finger 167..189 CDD:275368 5/21 (24%)
COG5048 <179..366 CDD:227381 73/190 (38%)
C2H2 Zn finger 197..219 CDD:275368 10/22 (45%)
C2H2 Zn finger 227..249 CDD:275368 8/21 (38%)
C2H2 Zn finger 257..279 CDD:275368 7/21 (33%)
C2H2 Zn finger 287..309 CDD:275368 7/21 (33%)
C2H2 Zn finger 317..339 CDD:275368 8/21 (38%)
C2H2 Zn finger 347..365 CDD:275368 5/20 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..402 6/36 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.