Sequence 1: | NP_609739.2 | Gene: | CG15269 / 34887 | FlyBaseID: | FBgn0028878 | Length: | 587 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001337908.1 | Gene: | ZSCAN25 / 221785 | HGNCID: | 21961 | Length: | 544 | Species: | Homo sapiens |
Alignment Length: | 211 | Identity: | 94/211 - (44%) |
---|---|---|---|
Similarity: | 125/211 - (59%) | Gaps: | 11/211 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 318 KTHKS--PRYECADCGKGFSQLRNYKYHLSVHRGTKEFAAECPECGKTFNDKGYLSSHLKIHRNR 380
Fly 381 KEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRFSRKMLLKQHMRTHSGEKPYQCSVCG 445
Fly 446 KSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTHLNYHTGCKPYVCPHPNCNQAFTQSS 510
Fly 511 NMRTHAKKCQYR--PL 524 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15269 | NP_609739.2 | C2H2 Zn finger | 300..320 | CDD:275368 | 1/1 (100%) |
COG5048 | <316..502 | CDD:227381 | 84/185 (45%) | ||
C2H2 Zn finger | 327..347 | CDD:275368 | 9/19 (47%) | ||
zf-C2H2 | 356..377 | CDD:278523 | 9/20 (45%) | ||
C2H2 Zn finger | 357..377 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 369..394 | CDD:290200 | 9/24 (38%) | ||
C2H2 Zn finger | 385..405 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 397..422 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 413..433 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 426..449 | CDD:290200 | 15/22 (68%) | ||
zf-C2H2 | 439..461 | CDD:278523 | 10/21 (48%) | ||
C2H2 Zn finger | 441..461 | CDD:275368 | 9/19 (47%) | ||
zf-C2H2 | 467..489 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 469..489 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 497..515 | CDD:275368 | 6/17 (35%) | ||
ZSCAN25 | NP_001337908.1 | SCAN | 38..136 | CDD:322011 | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 157..189 | ||||
KRAB_A-box | 231..>259 | CDD:143639 | |||
COG5048 | <324..532 | CDD:227381 | 88/198 (44%) | ||
C2H2 Zn finger | 350..370 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 377..397 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 405..425 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 433..453 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 461..480 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 488..508 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 516..535 | CDD:275368 | 7/21 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |