DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and sdz-12

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_494634.1 Gene:sdz-12 / 184388 WormBaseID:WBGene00017406 Length:330 Species:Caenorhabditis elegans


Alignment Length:313 Identity:71/313 - (22%)
Similarity:112/313 - (35%) Gaps:104/313 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 KCRICEKVFGCSETLQAHEK------------THKSPRYECADCGKGFSQLRNYKYHLSVHRGTK 351
            :|::|::.|...:||:.|.|            .||   :.|.:|.|.|:...|.|.|...|.|:|
 Worm    28 QCQVCKRKFANQKTLRTHMKHITCRPGRSNVVNHK---FRCENCEKQFTNKPNLKRHQITHSGSK 89

  Fly   352 EFAAECPECGKTFNDKGYLSSHLKIH-RNRKEYECPY--CPKSFNQRVAFNMHVRIHTGVKPHKC 413
              :.:|..|.:||..:..|..||..| :.|..::||.  |          :|....:.||:.|  
 Worm    90 --SKKCSTCQRTFFREDQLQRHLHNHLKERSHFDCPVLNC----------SMQFVFYEGVENH-- 140

  Fly   414 NECGKRFSRKMLLKQHMRTHSGEKPYQCSVCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTK 478
                       |:..|..::|...|     |||                         |.|.|..
 Worm   141 -----------LVNHHHFSYSESAP-----CGK-------------------------CHKLFGS 164

  Fly   479 KHHLKTHLNYHTGCKPYVCPHPNCNQAFTQSSNMRTHAKKCQYRPLDGLTVTSSALP---VPGKQ 540
            ..||..|  ||...|          :|...|:...|.:.:     |..:||::|..|   :....
 Worm   165 PRHLLVH--YHFDHK----------EALRSSAPAPTSSAR-----LSPITVSTSGSPRAQLAISP 212

  Fly   541 QTGPPPTLAM-----AMAQTF------QMPPPPGVLTPGSGPSQPPSQQTLLS 582
            |..||..|::     .|.:.|      .:|.....|:|...|::|..:..:.|
 Worm   213 QEKPPQKLSINLGTSPMIEEFCEQNSATLPNTDQQLSPTLSPNEPRFRNLITS 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 7/31 (23%)
COG5048 <316..502 CDD:227381 46/200 (23%)
C2H2 Zn finger 327..347 CDD:275368 7/19 (37%)
zf-C2H2 356..377 CDD:278523 7/20 (35%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
zf-H2C2_2 369..394 CDD:290200 8/27 (30%)
C2H2 Zn finger 385..405 CDD:275368 4/21 (19%)
zf-H2C2_2 397..422 CDD:290200 4/24 (17%)
C2H2 Zn finger 413..433 CDD:275368 2/19 (11%)
zf-H2C2_2 426..449 CDD:290200 6/22 (27%)
zf-C2H2 439..461 CDD:278523 3/21 (14%)
C2H2 Zn finger 441..461 CDD:275368 3/19 (16%)
zf-C2H2 467..489 CDD:278523 6/21 (29%)
C2H2 Zn finger 469..489 CDD:275368 6/19 (32%)
C2H2 Zn finger 497..515 CDD:275368 2/17 (12%)
sdz-12NP_494634.1 SFP1 <25..86 CDD:227516 16/60 (27%)
C2H2 Zn finger 29..48 CDD:275368 6/18 (33%)
COG5236 <32..>197 CDD:227561 54/239 (23%)
C2H2 Zn finger 65..85 CDD:275368 7/19 (37%)
C2H2 Zn finger 93..113 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.