DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and scrt-1

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_491001.2 Gene:scrt-1 / 183848 WormBaseID:WBGene00016948 Length:178 Species:Caenorhabditis elegans


Alignment Length:83 Identity:43/83 - (51%)
Similarity:56/83 - (67%) Gaps:2/83 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   412 KCNECGKRFSRKMLLKQHMRTHSGEKPYQCSVCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAF 476
            :|..|||||||:.||:.|:|||:||||:||.:|.|.|||:||:..|.:.|||.||..||.|.|:|
 Worm    95 QCKVCGKRFSRQWLLQGHLRTHTGEKPFQCEICSKRFADKSNLRAHIQTHSGTKPHKCPRCGKSF 159

  Fly   477 TKKHHLKTHLNYHTGCKP 494
            ..|.:|..|  ..:.|.|
 Worm   160 ALKSYLSKH--EESKCLP 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368
COG5048 <316..502 CDD:227381 43/83 (52%)
C2H2 Zn finger 327..347 CDD:275368
zf-C2H2 356..377 CDD:278523
C2H2 Zn finger 357..377 CDD:275368
zf-H2C2_2 369..394 CDD:290200
C2H2 Zn finger 385..405 CDD:275368
zf-H2C2_2 397..422 CDD:290200 6/9 (67%)
C2H2 Zn finger 413..433 CDD:275368 12/19 (63%)
zf-H2C2_2 426..449 CDD:290200 13/22 (59%)
zf-C2H2 439..461 CDD:278523 10/21 (48%)
C2H2 Zn finger 441..461 CDD:275368 9/19 (47%)
zf-C2H2 467..489 CDD:278523 8/21 (38%)
C2H2 Zn finger 469..489 CDD:275368 8/19 (42%)
C2H2 Zn finger 497..515 CDD:275368
scrt-1NP_491001.2 zf-C2H2 94..116 CDD:278523 12/20 (60%)
C2H2 Zn finger 96..116 CDD:275368 12/19 (63%)
zf-H2C2_2 109..132 CDD:290200 13/22 (59%)
C2H2 Zn finger 124..144 CDD:275368 9/19 (47%)
zf-H2C2_2 136..160 CDD:290200 11/23 (48%)
C2H2 Zn finger 152..168 CDD:275368 7/15 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.