DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and M03D4.4

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001023313.1 Gene:M03D4.4 / 177375 WormBaseID:WBGene00019751 Length:505 Species:Caenorhabditis elegans


Alignment Length:284 Identity:74/284 - (26%)
Similarity:118/284 - (41%) Gaps:58/284 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 YKCRICEKVFGCSETLQAHEKTHKSPRYECADCGKGFSQLRNYKYHLSVHRGTKE------FAAE 356
            |.||.|...|...:.||.||:                      :.|.:|.:|.:|      .:.|
 Worm     5 YLCRDCSGAFHSLDELQRHER----------------------EEHETVEQGDQEEDRMEDDSDE 47

  Fly   357 CPECGKTFNDKGYL----SSHLKIH----------RNRKEYECPYCPKSFNQRVAFNMHVRIHTG 407
            .........|..:|    ||.|.::          ..:..|||..|.:.|..:.....|:|||:|
 Worm    48 LAMIKIKIEDSDFLSDTDSSQLSMNPTTPSEKSSSGEKGRYECEDCHEMFAVKRELATHMRIHSG 112

  Fly   408 VKPHKCNECGKRFSRKMLLKQHMRTHSGEKPYQCSVCGKSFADRSNMTLHHRLHSGIKPFSCPLC 472
            .:||.|.:|||.|..:.|||:|...|:||:.:.|..|.|:|..:.::|.|..:|||.:|..||.|
 Worm   113 EQPHSCTQCGKEFGTRQLLKKHWMWHTGERSHVCPHCNKAFFQKGHLTQHLMIHSGGRPHECPQC 177

  Fly   473 PKAFTKKHHLKTHLNYHTGCKPYVCPHPNCNQAFTQSSNMRTHAKKCQYRPLDGLTVTSSALPVP 537
            .|.|..|..|..|:..|.. :.:.|  ..|.::|.:...:..|..||:.:|         :.|: 
 Worm   178 HKTFIFKFDLNRHMKIHQE-RGFSC--QQCGRSFLKQVMLDEHHLKCKGKP---------SSPI- 229

  Fly   538 GKQQTGPPPTLAMAMAQTFQMPPP 561
               ::...||:...:.....:.||
 Worm   230 ---RSLLTPTMKAGLESAISIKPP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 8/19 (42%)
COG5048 <316..502 CDD:227381 56/205 (27%)
C2H2 Zn finger 327..347 CDD:275368 1/19 (5%)
zf-C2H2 356..377 CDD:278523 6/24 (25%)
C2H2 Zn finger 357..377 CDD:275368 5/23 (22%)
zf-H2C2_2 369..394 CDD:290200 9/38 (24%)
C2H2 Zn finger 385..405 CDD:275368 5/19 (26%)
zf-H2C2_2 397..422 CDD:290200 12/24 (50%)
C2H2 Zn finger 413..433 CDD:275368 9/19 (47%)
zf-H2C2_2 426..449 CDD:290200 9/22 (41%)
zf-C2H2 439..461 CDD:278523 6/21 (29%)
C2H2 Zn finger 441..461 CDD:275368 6/19 (32%)
zf-C2H2 467..489 CDD:278523 8/21 (38%)
C2H2 Zn finger 469..489 CDD:275368 8/19 (42%)
C2H2 Zn finger 497..515 CDD:275368 3/17 (18%)
M03D4.4NP_001023313.1 C2H2 Zn finger 90..110 CDD:275368 5/19 (26%)
zf-H2C2_2 102..127 CDD:290200 12/24 (50%)
C2H2 Zn finger 118..138 CDD:275368 9/19 (47%)
C2H2 Zn finger 146..166 CDD:275368 6/19 (32%)
zf-H2C2_2 158..181 CDD:290200 10/22 (45%)
zf-C2H2 172..194 CDD:278523 8/21 (38%)
C2H2 Zn finger 174..194 CDD:275368 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.