DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG15269 and ztf-23

DIOPT Version :9

Sequence 1:	NP_609739.2	Gene:	CG15269 / 34887	FlyBaseID:	FBgn0028878	Length:	587	Species:	Drosophila melanogaster
Sequence 2:	NP_491096.1	Gene:	ztf-23 / 171880	WormBaseID:	WBGene00021846	Length:	419	Species:	Caenorhabditis elegans

Alignment Length:	136	Identity:	54/136 - (39%)
Similarity:	78/136 - (57%)	Gaps:	8/136 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly   356 ECPECGKTFNDKGYLSSHLKIHRNRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRF 420
            :|...|..|.| |..:|. |:.|    :.|..|.::|..:...:.|.|.|.||||.:|:.|.::|
Worm   228 DCSTSGVAFAD-GQTNSG-KMGR----FSCDRCSRTFKYQSKLDEHRRTHLGVKPFQCHYCTRQF 286

  Fly   421 SRKMLLKQHMRTHSGEKPYQCS-VCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKT 484
            |::..||.|||.|:||:|:.|. .|||.||..|..:.|.:.|||.:|:.|.:|.|:|||..|:..
Worm   287 SQRGALKTHMRLHTGERPFVCQWECGKQFASSSAKSHHEKTHSGERPYICNVCGKSFTKNSHVIR 351

  Fly   485 HL-NYH 489
            || |.|
Worm   352 HLKNIH 357

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG15269	NP_609739.2	C2H2 Zn finger	300..320	CDD:275368
		COG5048	<316..502	CDD:227381	54/136 (40%)
		C2H2 Zn finger	327..347	CDD:275368
		zf-C2H2	356..377	CDD:278523	7/20 (35%)
		C2H2 Zn finger	357..377	CDD:275368	7/19 (37%)
		zf-H2C2_2	369..394	CDD:290200	6/24 (25%)
		C2H2 Zn finger	385..405	CDD:275368	5/19 (26%)
		zf-H2C2_2	397..422	CDD:290200	10/24 (42%)
		C2H2 Zn finger	413..433	CDD:275368	9/19 (47%)
		zf-H2C2_2	426..449	CDD:290200	13/23 (57%)
		zf-C2H2	439..461	CDD:278523	8/22 (36%)
		C2H2 Zn finger	441..461	CDD:275368	8/20 (40%)
		zf-C2H2	467..489	CDD:278523	10/22 (45%)
		C2H2 Zn finger	469..489	CDD:275368	10/20 (50%)
		C2H2 Zn finger	497..515	CDD:275368
ztf-23	NP_491096.1	C2H2 Zn finger	251..271	CDD:275368	5/19 (26%)
		zf-H2C2_2	264..288	CDD:290200	10/23 (43%)
		C2H2 Zn finger	279..299	CDD:275368	9/19 (47%)
		zf-H2C2_2	291..317	CDD:290200	14/25 (56%)
		C2H2 Zn finger	307..328	CDD:275368	8/20 (40%)
		zf-H2C2_2	324..344	CDD:290200	8/19 (42%)
		C2H2 Zn finger	336..357	CDD:275368	10/20 (50%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24384
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.100