DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and ZNF679

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_699194.2 Gene:ZNF679 / 168417 HGNCID:28650 Length:411 Species:Homo sapiens


Alignment Length:425 Identity:132/425 - (31%)
Similarity:183/425 - (43%) Gaps:65/425 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 FAPYVINGSVPPPPPLQQQQQPLIR-----------TKSTACTRPDCPECLDYYQRLQTGGYKQT 205
            |...||..|:.....|...||.|.|           :...|.::||...||:  |..:....|:.
Human    18 FRDVVIEFSLEEWQCLDHAQQNLYRDVMLENYRNLVSLGIAVSKPDLITCLE--QNKEPWNIKRN 80

  Fly   206 APLISPAASSVSSSTGSIRP---VRD----LIMSATGGAASTNISLTTVTNLSLNSVQATAVGMM 263
             .:::......|..|..:.|   ::|    :|....|.:...|:.:.|..::....||.      
Human    81 -EMVTKHPVMCSHFTQDLPPELGIKDSLQKVIPRRYGKSGHDNLQVKTCKSMGECEVQK------ 138

  Fly   264 PKMTGGLITTAVGSNSGAIGGIGGYN---ATSAEEISYKCRICEKVFGCSETLQAHEKTHKSPR- 324
                               ||....|   :|:..:| ::...|.||||.......|:..|...: 
Human   139 -------------------GGCNEVNQCLSTTQNKI-FQTHKCVKVFGKFSNSNRHKTRHTGKKH 183

  Fly   325 YECADCGKGFSQLRNYKYHLSVHRGTKEFAAECPECGKTFNDKGYLSSHLKIHRNRKEYECPYCP 389
            ::|...||.|..:.....|..:|  |:|.:.:|.||||.||....||.|.:||...|.|.|..|.
Human   184 FKCKKYGKSFCMVSQLHQHQIIH--TRENSYQCEECGKPFNCSSTLSKHKRIHTGEKPYRCEECG 246

  Fly   390 KSFNQRVAFNMHVRIHTGVKPHKCNECGKRFSRKMLLKQHMRTHSGEKPYQCSVCGKSFADRSNM 454
            |:|........|.|||||.||:.|.|||:.|||...|..|.|.|:|||||.|..|||:|:..|::
Human   247 KAFTWSSTLTKHRRIHTGEKPYTCEECGQAFSRSSTLANHKRIHTGEKPYTCEECGKAFSLSSSL 311

  Fly   455 TLHHRLHSGIKPFSCPLCPKAFTKKHHLKTHLNYHTGCKPYVCPHPNCNQAFTQSSNMRTHAK-- 517
            |.|.|:|:|.||::|..|.|||.....||.|...|||.|||.|  ..|.:||..||.:.||.:  
Human   312 TYHKRIHTGEKPYTCEECGKAFNCSSTLKKHKIIHTGEKPYKC--KECGKAFAFSSTLNTHKRIH 374

  Fly   518 ------KCQYRPLDGLTVTSSALPVPGKQQTGPPP 546
                  ||:  ..|.....||:|.......||..|
Human   375 TGEEPYKCE--ECDKAFKWSSSLANHKSMHTGEKP 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 6/19 (32%)
COG5048 <316..502 CDD:227381 80/186 (43%)
C2H2 Zn finger 327..347 CDD:275368 5/19 (26%)
zf-C2H2 356..377 CDD:278523 10/20 (50%)
C2H2 Zn finger 357..377 CDD:275368 10/19 (53%)
zf-H2C2_2 369..394 CDD:290200 11/24 (46%)
C2H2 Zn finger 385..405 CDD:275368 6/19 (32%)
zf-H2C2_2 397..422 CDD:290200 13/24 (54%)
C2H2 Zn finger 413..433 CDD:275368 10/19 (53%)
zf-H2C2_2 426..449 CDD:290200 13/22 (59%)
zf-C2H2 439..461 CDD:278523 10/21 (48%)
C2H2 Zn finger 441..461 CDD:275368 9/19 (47%)
zf-C2H2 467..489 CDD:278523 8/21 (38%)
C2H2 Zn finger 469..489 CDD:275368 8/19 (42%)
C2H2 Zn finger 497..515 CDD:275368 6/17 (35%)
ZNF679NP_699194.2 KRAB 16..76 CDD:214630 15/59 (25%)
KRAB 16..55 CDD:279668 9/36 (25%)
C2H2 Zn finger 159..178 CDD:275368 6/18 (33%)
C2H2 Zn finger 186..206 CDD:275368 5/19 (26%)
C2H2 Zn finger 214..234 CDD:275368 10/19 (53%)
zf-H2C2_2 227..250 CDD:290200 10/22 (45%)
COG5048 <238..401 CDD:227381 71/166 (43%)
C2H2 Zn finger 242..262 CDD:275368 6/19 (32%)
zf-H2C2_2 255..279 CDD:290200 13/23 (57%)
C2H2 Zn finger 270..290 CDD:275368 10/19 (53%)
zf-H2C2_2 283..306 CDD:290200 13/22 (59%)
C2H2 Zn finger 298..318 CDD:275368 9/19 (47%)
zf-H2C2_2 310..335 CDD:290200 12/24 (50%)
C2H2 Zn finger 326..346 CDD:275368 8/19 (42%)
zf-H2C2_2 339..362 CDD:290200 12/24 (50%)
C2H2 Zn finger 354..374 CDD:275368 8/21 (38%)
zf-H2C2_2 367..390 CDD:290200 5/24 (21%)
C2H2 Zn finger 382..402 CDD:275368 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24384
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.