DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and ZNF114

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001318027.1 Gene:ZNF114 / 163071 HGNCID:12894 Length:463 Species:Homo sapiens


Alignment Length:399 Identity:102/399 - (25%)
Similarity:151/399 - (37%) Gaps:87/399 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 PHLLPAYAAAAAAAGLSTPPTSPYQTHQHQQHLPNQQKRFFAPY--VINGSVPPPPPLQQQQQPL 174
            |.:||......|.....|..:|.:.|.:.....|..::    |:  .:|...||....::.:.|:
Human   106 PDILPKRTFPEANRVCLTSISSQHSTLREDWRCPKTEE----PHRQGVNNVKPPAVAPEKDESPV 166

  Fly   175 IRTKSTACTRPDCPECLDYYQRLQTGGYKQTAPLISPAASSV-------SSSTGSIRPVRDLIMS 232
                         ..|.|:..|..:   |.|..|:.....|:       .||.....||      
Human   167 -------------SICEDHEMRNHS---KPTCRLVPSQGDSIRQCILTRDSSIFKYNPV------ 209

  Fly   233 ATGGAASTNISLTTVTNLSLNSVQATAVGMMP--KMTGGLITTAVGS-----------NSGA--- 281
                   .|.|..|..|...:.|....:..:|  :.|....:|..||           ::||   
Human   210 -------LNDSQKTHENNEDDGVLGWNIQWVPCGRKTELKSSTWTGSQNTVHHIRDEIDTGANRH 267

  Fly   282 -----------IGGIGGYNATSAEEISYKCRICEKVFGCSETLQAHEKTHKSPRYECADCGKGFS 335
                       .|.:..:| |...|..|....||.. ..:.::.|.:....:......||..|.:
Human   268 QRNPFGKAFREDGSLRAHN-THGREKMYDFTQCENT-SRNNSIHAMQMQLYTAETNKKDCQTGAT 330

  Fly   336 QLR-----NYKYHLSVHRGTKEFAAECPECGKTFNDKGYLSSHLKIHRNRKEYECPYCPKSFNQR 395
            ...     ::|.|.     |.|...:|||||:.|..:.:|..|:|||...|.|||..|.|:|...
Human   331 SANAPNSGSHKSHC-----TGEKTHKCPECGRAFFYQSFLMRHMKIHTGEKPYECGKCGKAFRYS 390

  Fly   396 VAFNMHVRIH-TGVKPHKCNECGK--RFSRKMLLKQHMRTHSGEKPYQCSVCGKSFADRSNMTLH 457
            :..|.|:|.| ...||::|.||||  |.|.|.   .|:|:|:|||||:|..|||.||..|.:..|
Human   391 LHLNKHLRKHVVQKKPYECEECGKVIRESSKY---THIRSHTGEKPYKCKTCGKDFAKSSGLKKH 452

  Fly   458 HRLHSGIKP 466
            .:.|...||
Human   453 LKTHKDEKP 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 3/19 (16%)
COG5048 <316..502 CDD:227381 58/159 (36%)
C2H2 Zn finger 327..347 CDD:275368 5/24 (21%)
zf-C2H2 356..377 CDD:278523 9/20 (45%)
C2H2 Zn finger 357..377 CDD:275368 9/19 (47%)
zf-H2C2_2 369..394 CDD:290200 12/24 (50%)
C2H2 Zn finger 385..405 CDD:275368 7/19 (37%)
zf-H2C2_2 397..422 CDD:290200 12/27 (44%)
C2H2 Zn finger 413..433 CDD:275368 10/21 (48%)
zf-H2C2_2 426..449 CDD:290200 12/22 (55%)
zf-C2H2 439..461 CDD:278523 9/21 (43%)
C2H2 Zn finger 441..461 CDD:275368 8/19 (42%)
zf-C2H2 467..489 CDD:278523 102/399 (26%)
C2H2 Zn finger 469..489 CDD:275368
C2H2 Zn finger 497..515 CDD:275368
ZNF114NP_001318027.1 KRAB 52..111 CDD:214630 2/4 (50%)
KRAB 52..91 CDD:279668
zf-C2H2 350..372 CDD:278523 9/21 (43%)
C2H2 Zn finger 352..372 CDD:275368 9/19 (47%)
zf-H2C2_2 365..389 CDD:290200 12/23 (52%)
C2H2 Zn finger 380..428 CDD:275368 20/50 (40%)
Ribosomal_L37ae 388..>445 CDD:302811 27/59 (46%)
zf-H2C2_2 423..444 CDD:290200 12/20 (60%)
zf-C2H2 434..456 CDD:278523 9/21 (43%)
C2H2 Zn finger 436..456 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24384
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.