DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and ZNF98

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001092096.1 Gene:ZNF98 / 148198 HGNCID:13174 Length:572 Species:Homo sapiens


Alignment Length:253 Identity:103/253 - (40%)
Similarity:141/253 - (55%) Gaps:21/253 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 SNSGAIGGIGGYNATSAEEISYKCRICEKVFGCSETLQAHEKTHKSPR-YECADCGKGFSQLRNY 340
            ||...||..|        :.|:||:.|||.|.....|..|::.|...: |:|.:|||.:::..|.
Human   169 SNRHKIGHTG--------KKSFKCKECEKSFCMLSHLAQHKRIHSGEKPYKCKECGKAYNEASNL 225

  Fly   341 KYHLSVHRGTKEFAAECPECGKTFNDKGYLSSHLKIHRNRKEYECPYCPKSFNQRVAFNMHVRIH 405
            ..|..:|.|.|.:  :|.||||.||...:|::|..||..:|.|:|..|.|:|||......|.|||
Human   226 STHKRIHTGKKPY--KCEECGKAFNRLSHLTTHKIIHTGKKPYKCEECGKAFNQSANLTTHKRIH 288

  Fly   406 TGVKPHKCNECGKRFSRKMLLKQHMRTHSGEKPYQCSVCGKSFADRSNMTLHHRLHSGIKPFSCP 470
            ||.||:||.|||:.||:...|..|...|:|||||:|..|||:|:..|.:|.|..:|:|.|.:.|.
Human   289 TGEKPYKCEECGRAFSQSSTLTAHKIIHAGEKPYKCEECGKAFSQSSTLTTHKIIHTGEKFYKCE 353

  Fly   471 LCPKAFTKKHHLKTHLNYHTGCKPYVCPHPNCNQAFTQSSNMRTHAK--------KCQ 520
            .|.|||::..||.||...|:|.|||.|  ..|.:||.|||.:.||.:        ||:
Human   354 ECGKAFSRLSHLTTHKRIHSGEKPYKC--EECGKAFKQSSTLTTHKRIHAGEKFYKCE 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 7/19 (37%)
COG5048 <316..502 CDD:227381 80/186 (43%)
C2H2 Zn finger 327..347 CDD:275368 6/19 (32%)
zf-C2H2 356..377 CDD:278523 9/20 (45%)
C2H2 Zn finger 357..377 CDD:275368 9/19 (47%)
zf-H2C2_2 369..394 CDD:290200 10/24 (42%)
C2H2 Zn finger 385..405 CDD:275368 8/19 (42%)
zf-H2C2_2 397..422 CDD:290200 14/24 (58%)
C2H2 Zn finger 413..433 CDD:275368 8/19 (42%)
zf-H2C2_2 426..449 CDD:290200 12/22 (55%)
zf-C2H2 439..461 CDD:278523 9/21 (43%)
C2H2 Zn finger 441..461 CDD:275368 8/19 (42%)
zf-C2H2 467..489 CDD:278523 9/21 (43%)
C2H2 Zn finger 469..489 CDD:275368 9/19 (47%)
C2H2 Zn finger 497..515 CDD:275368 7/17 (41%)
ZNF98NP_001092096.1 KRAB 13..73 CDD:214630
KRAB 13..52 CDD:279668
COG5048 179..563 CDD:227381 98/235 (42%)
C2H2 Zn finger 184..204 CDD:275368 7/19 (37%)
zf-H2C2_2 196..220 CDD:290200 8/23 (35%)
C2H2 Zn finger 212..232 CDD:275368 6/19 (32%)
zf-H2C2_2 224..249 CDD:290200 11/26 (42%)
C2H2 Zn finger 240..260 CDD:275368 9/19 (47%)
zf-H2C2_2 252..277 CDD:290200 10/24 (42%)
C2H2 Zn finger 268..288 CDD:275368 8/19 (42%)
zf-H2C2_2 280..305 CDD:290200 14/24 (58%)
C2H2 Zn finger 296..316 CDD:275368 8/19 (42%)
C2H2 Zn finger 324..344 CDD:275368 8/19 (42%)
zf-H2C2_2 337..361 CDD:290200 10/23 (43%)
zf-C2H2 350..372 CDD:278523 9/21 (43%)
C2H2 Zn finger 352..372 CDD:275368 9/19 (47%)
zf-H2C2_2 364..389 CDD:290200 13/26 (50%)
C2H2 Zn finger 380..400 CDD:275368 9/21 (43%)
C2H2 Zn finger 408..428 CDD:275368 1/2 (50%)
zf-H2C2_2 420..444 CDD:290200
C2H2 Zn finger 436..456 CDD:275368
zf-H2C2_2 449..473 CDD:290200
C2H2 Zn finger 464..484 CDD:275368
zf-H2C2_2 477..501 CDD:290200
C2H2 Zn finger 492..512 CDD:275368
zf-H2C2_2 504..529 CDD:290200
C2H2 Zn finger 520..540 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24384
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.