DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG15269 and Snai1

DIOPT Version :9

Sequence 1:	NP_609739.2	Gene:	CG15269 / 34887	FlyBaseID:	FBgn0028878	Length:	587	Species:	Drosophila melanogaster
Sequence 2:	NP_446257.1	Gene:	Snai1 / 116490	RGDID:	620758	Length:	264	Species:	Rattus norvegicus

Alignment Length:	135	Identity:	55/135 - (40%)
Similarity:	75/135 - (55%)	Gaps:	10/135 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly   364 FNDKGYLSSHL------KIHRNRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRFSR 422
            |...|.|...|      |..::||.:.|.||.|.:....|..||:|.||  .|..|..|||.|||
  Rat   129 FPGLGQLPKQLARLSVAKDPQSRKAFNCKYCNKEYLSLGALKMHIRSHT--LPCVCTTCGKAFSR 191

  Fly   423 KMLLKQHMRTHSGEKPYQCSVCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTHLN 487
            ..||:.|:|||:||||:.||.|.::||||||:..|.:.||.:|.:.|..|.:.|::...|  |.:
  Rat   192 PWLLQGHVRTHTGEKPFSCSHCNRAFADRSNLRAHLQTHSDVKRYQCQACARTFSRMSLL--HKH 254

  Fly   488 YHTGC 492
            ..:||
  Rat   255 QESGC 259

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG15269	NP_609739.2	C2H2 Zn finger	300..320	CDD:275368
		COG5048	<316..502	CDD:227381	55/135 (41%)
		C2H2 Zn finger	327..347	CDD:275368
		zf-C2H2	356..377	CDD:278523	5/18 (28%)
		C2H2 Zn finger	357..377	CDD:275368	5/18 (28%)
		zf-H2C2_2	369..394	CDD:290200	9/30 (30%)
		C2H2 Zn finger	385..405	CDD:275368	8/19 (42%)
		zf-H2C2_2	397..422	CDD:290200	12/24 (50%)
		C2H2 Zn finger	413..433	CDD:275368	11/19 (58%)
		zf-H2C2_2	426..449	CDD:290200	12/22 (55%)
		zf-C2H2	439..461	CDD:278523	10/21 (48%)
		C2H2 Zn finger	441..461	CDD:275368	10/19 (53%)
		zf-C2H2	467..489	CDD:278523	5/21 (24%)
		C2H2 Zn finger	469..489	CDD:275368	5/19 (26%)
		C2H2 Zn finger	497..515	CDD:275368
Snai1	NP_446257.1	C2H2 Zn finger	156..176	CDD:275368	8/19 (42%)
		COG5048	<177..>253	CDD:227381	36/79 (46%)
		zf-C2H2	180..202	CDD:278523	11/21 (52%)
		C2H2 Zn finger	182..202	CDD:275368	11/19 (58%)
		zf-H2C2_2	195..218	CDD:290200	12/22 (55%)
		zf-C2H2	208..230	CDD:278523	10/21 (48%)
		C2H2 Zn finger	210..230	CDD:275368	10/19 (53%)
		C2H2 Zn finger	238..255	CDD:275368	5/18 (28%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	2	1.910