DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and Zfp37

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_478116.2 Gene:Zfp37 / 115768 RGDID:620723 Length:626 Species:Rattus norvegicus


Alignment Length:245 Identity:101/245 - (41%)
Similarity:135/245 - (55%) Gaps:18/245 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 YKCRICEKVFGCSETLQAHEKTHKSPR-YECADCGKGFSQLRNYKYHLSVHRGTKEFAAECPECG 361
            |:|..|.||....:.|..|::||...: |||.:||..|||..:...|...|.|.|.:  ||.:||
  Rat   287 YECNQCGKVLSHKQGLLDHQRTHTGEKPYECNECGIAFSQKSHLVVHQRTHTGEKPY--ECVQCG 349

  Fly   362 KTFNDKGYLSSHLKIHRNRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRFSRKMLL 426
            |....|..|:.||:||...|.|:|..|.|:|........|:|.|||.||::|.||||.|.....|
  Rat   350 KAHGHKHALTDHLRIHTGEKPYKCNECGKTFRHSSNLMQHIRSHTGEKPYECKECGKSFRYNSSL 414

  Fly   427 KQHMRTHSGEKPYQCSVCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTHLNYHTG 491
            .:|:|||:||.||:|:.|||:|...|::|.|.|:|:|.|||.|..|.|.|:||.||..|...||.
  Rat   415 TEHVRTHTGEIPYECNECGKAFKYGSSLTKHMRIHTGEKPFECTECGKTFSKKSHLVIHQRTHTK 479

  Fly   492 CKPYVCPHPNCNQAFTQSS----NMRTHAKKC---------QYRPLDGLT 528
            .|||.|  ..|.:||..||    ::|||...|         .::.::|||
  Rat   480 EKPYKC--KECGKAFGHSSSLTYHLRTHTGDCPFECNQCGKAFKQIEGLT 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 6/19 (32%)
COG5048 <316..502 CDD:227381 83/186 (45%)
C2H2 Zn finger 327..347 CDD:275368 7/19 (37%)
zf-C2H2 356..377 CDD:278523 9/20 (45%)
C2H2 Zn finger 357..377 CDD:275368 8/19 (42%)
zf-H2C2_2 369..394 CDD:290200 11/24 (46%)
C2H2 Zn finger 385..405 CDD:275368 6/19 (32%)
zf-H2C2_2 397..422 CDD:290200 13/24 (54%)
C2H2 Zn finger 413..433 CDD:275368 9/19 (47%)
zf-H2C2_2 426..449 CDD:290200 13/22 (59%)
zf-C2H2 439..461 CDD:278523 10/21 (48%)
C2H2 Zn finger 441..461 CDD:275368 9/19 (47%)
zf-C2H2 467..489 CDD:278523 10/21 (48%)
C2H2 Zn finger 469..489 CDD:275368 9/19 (47%)
C2H2 Zn finger 497..515 CDD:275368 7/21 (33%)
Zfp37NP_478116.2 KRAB_A-box 28..68 CDD:143639
KRAB 41..89 CDD:214630
COG5048 124..518 CDD:227381 98/234 (42%)
C2H2 Zn finger 243..262 CDD:275368
C2H2 Zn finger 289..309 CDD:275368 6/19 (32%)
zf-H2C2_2 302..326 CDD:290200 10/23 (43%)
C2H2 Zn finger 317..337 CDD:275368 7/19 (37%)
zf-H2C2_2 329..351 CDD:290200 8/23 (35%)
C2H2 Zn finger 345..365 CDD:275368 8/19 (42%)
zf-H2C2_2 357..382 CDD:290200 11/24 (46%)
zf-C2H2 371..393 CDD:278523 7/21 (33%)
C2H2 Zn finger 373..393 CDD:275368 6/19 (32%)
zf-H2C2_2 385..410 CDD:290200 13/24 (54%)
C2H2 Zn finger 401..421 CDD:275368 9/19 (47%)
zf-H2C2_2 413..438 CDD:290200 14/24 (58%)
C2H2 Zn finger 429..449 CDD:275368 9/19 (47%)
zf-H2C2_2 441..465 CDD:290200 11/23 (48%)
C2H2 Zn finger 457..477 CDD:275368 9/19 (47%)
zf-H2C2_2 469..492 CDD:290200 10/24 (42%)
C2H2 Zn finger 485..505 CDD:275368 7/21 (33%)
C2H2 Zn finger 513..533 CDD:275368 3/15 (20%)
zf-H2C2_2 526..550 CDD:290200 2/2 (100%)
C2H2 Zn finger 541..561 CDD:275368
zf-H2C2_2 553..577 CDD:290200
COG5048 565..>626 CDD:227381
C2H2 Zn finger 569..589 CDD:275368
zf-H2C2_2 582..606 CDD:290200
C2H2 Zn finger 597..617 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.