DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and ZNF211

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001252526.1 Gene:ZNF211 / 10520 HGNCID:13003 Length:629 Species:Homo sapiens


Alignment Length:263 Identity:101/263 - (38%)
Similarity:140/263 - (53%) Gaps:37/263 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 AEEISYKCRICEKVFGCSETLQAHEKTHKSPR-YECADCGKGFSQLRNYKYHLSVHRGTKEFAAE 356
            :||..|:|..|.|.|....:...|::.|...| |.|.:|||.|||:.:...|..||.|.:.:  |
Human   345 SEERPYECNECGKFFTYYSSFIIHQRVHTGERPYACPECGKSFSQIYSLNSHRKVHTGERPY--E 407

  Fly   357 CPECGKTFNDKGYLSSHLKIHRNRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRFS 421
            |.||||:|:.:..|..|.::|...:.|||..|.|||:|..:...|.|:|||.:||:||||||.||
Human   408 CGECGKSFSQRSNLMQHRRVHTGERPYECSECGKSFSQNFSLIYHQRVHTGERPHECNECGKSFS 472

  Fly   422 RKMLLKQHMRTHSGEKPYQCS----------------------------VCGKSFADRSNMTLHH 458
            |...|..|.|.|:||:||:||                            .|||||:..||:..|.
Human   473 RSSSLIHHRRLHTGERPYECSKCGKSFKQSSSFSSHRKVHTGERPYVCGECGKSFSHSSNLKNHQ 537

  Fly   459 RLHSGIKPFSCPLCPKAFTKKHHLKTHLNYHTGCKPYVCPHPNCNQAFTQSSNM----RTHAKKC 519
            |:|:|.:|..|..|.|:|:.|.:|..||..|||.:||.|  ..|.::|:|||::    |.|..|.
Human   538 RVHTGERPVECSECSKSFSCKSNLIKHLRVHTGERPYEC--SECGKSFSQSSSLIQHRRVHTGKR 600

  Fly   520 QYR 522
            .|:
Human   601 PYQ 603

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 5/19 (26%)
COG5048 <316..502 CDD:227381 85/214 (40%)
C2H2 Zn finger 327..347 CDD:275368 8/19 (42%)
zf-C2H2 356..377 CDD:278523 9/20 (45%)
C2H2 Zn finger 357..377 CDD:275368 8/19 (42%)
zf-H2C2_2 369..394 CDD:290200 10/24 (42%)
C2H2 Zn finger 385..405 CDD:275368 8/19 (42%)
zf-H2C2_2 397..422 CDD:290200 14/24 (58%)
C2H2 Zn finger 413..433 CDD:275368 12/19 (63%)
zf-H2C2_2 426..449 CDD:290200 14/50 (28%)
zf-C2H2 439..461 CDD:278523 12/49 (24%)
C2H2 Zn finger 441..461 CDD:275368 11/47 (23%)
zf-C2H2 467..489 CDD:278523 8/21 (38%)
C2H2 Zn finger 469..489 CDD:275368 8/19 (42%)
C2H2 Zn finger 497..515 CDD:275368 7/21 (33%)
ZNF211NP_001252526.1 KRAB 46..106 CDD:214630
KRAB 46..85 CDD:279668
COG5048 244..615 CDD:227381 101/263 (38%)
C2H2 Zn finger 299..316 CDD:275368
C2H2 Zn finger 324..344 CDD:275368
zf-H2C2_2 336..361 CDD:290200 7/15 (47%)
C2H2 Zn finger 352..372 CDD:275368 5/19 (26%)
zf-H2C2_2 368..389 CDD:290200 9/20 (45%)
C2H2 Zn finger 380..400 CDD:275368 8/19 (42%)
zf-H2C2_2 392..417 CDD:290200 11/26 (42%)
C2H2 Zn finger 408..428 CDD:275368 8/19 (42%)
zf-H2C2_2 420..445 CDD:290200 10/24 (42%)
C2H2 Zn finger 436..456 CDD:275368 8/19 (42%)
zf-H2C2_2 448..473 CDD:290200 14/24 (58%)
C2H2 Zn finger 464..484 CDD:275368 12/19 (63%)
zf-C2H2 518..540 CDD:278523 9/21 (43%)
C2H2 Zn finger 520..540 CDD:275368 9/19 (47%)
zf-H2C2_2 532..557 CDD:290200 10/24 (42%)
C2H2 Zn finger 548..568 CDD:275368 8/19 (42%)
zf-H2C2_2 560..585 CDD:290200 11/26 (42%)
C2H2 Zn finger 576..596 CDD:275368 7/21 (33%)
zf-H2C2_2 588..611 CDD:290200 4/16 (25%)
C2H2 Zn finger 604..624 CDD:275368 101/263 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.