Sequence 1: | NP_609739.2 | Gene: | CG15269 / 34887 | FlyBaseID: | FBgn0028878 | Length: | 587 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017211236.1 | Gene: | si:dkey-30f3.2 / 103910879 | ZFINID: | ZDB-GENE-110913-70 | Length: | 301 | Species: | Danio rerio |
Alignment Length: | 224 | Identity: | 85/224 - (37%) |
---|---|---|---|
Similarity: | 123/224 - (54%) | Gaps: | 5/224 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 295 EISYKCRICEKVFGCSETLQAHEKTHKSPR-YECADCGKGFSQLRNYKYHLSVHRGTKEFAAECP 358
Fly 359 ECGKTFNDKGYLSSHLKIHRNRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRFSRK 423
Fly 424 MLLKQHMRTHSGEKPYQCSVCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTHLNY 488
Fly 489 HTGCKPYVCPHPNCNQAFTQSSNMRTHAK 517 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15269 | NP_609739.2 | C2H2 Zn finger | 300..320 | CDD:275368 | 6/19 (32%) |
COG5048 | <316..502 | CDD:227381 | 72/186 (39%) | ||
C2H2 Zn finger | 327..347 | CDD:275368 | 8/19 (42%) | ||
zf-C2H2 | 356..377 | CDD:278523 | 8/20 (40%) | ||
C2H2 Zn finger | 357..377 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 369..394 | CDD:290200 | 9/24 (38%) | ||
C2H2 Zn finger | 385..405 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 397..422 | CDD:290200 | 13/24 (54%) | ||
C2H2 Zn finger | 413..433 | CDD:275368 | 10/19 (53%) | ||
zf-H2C2_2 | 426..449 | CDD:290200 | 13/22 (59%) | ||
zf-C2H2 | 439..461 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 441..461 | CDD:275368 | 7/19 (37%) | ||
zf-C2H2 | 467..489 | CDD:278523 | 8/21 (38%) | ||
C2H2 Zn finger | 469..489 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 497..515 | CDD:275368 | 5/17 (29%) | ||
si:dkey-30f3.2 | XP_017211236.1 | C2H2 Zn finger | 50..69 | CDD:275368 | |
zf-H2C2_2 | 61..84 | CDD:290200 | 5/11 (45%) | ||
C2H2 Zn finger | 77..97 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 89..112 | CDD:290200 | 8/22 (36%) | ||
C2H2 Zn finger | 105..125 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 117..142 | CDD:290200 | 9/26 (35%) | ||
COG5048 | <130..280 | CDD:227381 | 59/153 (39%) | ||
C2H2 Zn finger | 133..153 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 161..181 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 176..198 | CDD:290200 | 13/21 (62%) | ||
C2H2 Zn finger | 189..209 | CDD:275368 | 10/19 (53%) | ||
zf-H2C2_2 | 201..226 | CDD:290200 | 14/24 (58%) | ||
C2H2 Zn finger | 217..234 | CDD:275368 | 6/16 (38%) | ||
C2H2 Zn finger | 245..265 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 273..293 | CDD:275368 | 7/21 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |