Sequence 1: | NP_609739.2 | Gene: | CG15269 / 34887 | FlyBaseID: | FBgn0028878 | Length: | 587 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017454117.1 | Gene: | LOC102556092 / 102556092 | RGDID: | 7677226 | Length: | 261 | Species: | Rattus norvegicus |
Alignment Length: | 229 | Identity: | 93/229 - (40%) |
---|---|---|---|
Similarity: | 126/229 - (55%) | Gaps: | 9/229 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 295 EISYKCRICEKVFGCSETLQAHEKTHKSPR-YECADCGKGFSQLRNYKYHLSVHRGTKEFAAECP 358
Fly 359 ECGKTFNDKGYLSSHLKIHRNRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRFSRK 423
Fly 424 MLLKQHMRTHSGEKPYQCSVCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTHLNY 488
Fly 489 HTGCKPYVCPHPNCNQAFTQSSNM----RTHAKK 518 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15269 | NP_609739.2 | C2H2 Zn finger | 300..320 | CDD:275368 | 6/19 (32%) |
COG5048 | <316..502 | CDD:227381 | 78/186 (42%) | ||
C2H2 Zn finger | 327..347 | CDD:275368 | 8/19 (42%) | ||
zf-C2H2 | 356..377 | CDD:278523 | 9/20 (45%) | ||
C2H2 Zn finger | 357..377 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 369..394 | CDD:290200 | 8/24 (33%) | ||
C2H2 Zn finger | 385..405 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 397..422 | CDD:290200 | 15/24 (63%) | ||
C2H2 Zn finger | 413..433 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 426..449 | CDD:290200 | 13/22 (59%) | ||
zf-C2H2 | 439..461 | CDD:278523 | 9/21 (43%) | ||
C2H2 Zn finger | 441..461 | CDD:275368 | 8/19 (42%) | ||
zf-C2H2 | 467..489 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 469..489 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 497..515 | CDD:275368 | 7/21 (33%) | ||
LOC102556092 | XP_017454117.1 | C2H2 Zn finger | 5..25 | CDD:275368 | |
C2H2 Zn finger | 33..53 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 61..81 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 74..97 | CDD:404364 | 9/24 (38%) | ||
C2H2 Zn finger | 89..109 | CDD:275368 | 9/19 (47%) | ||
COG5048 | <94..256 | CDD:227381 | 68/161 (42%) | ||
C2H2 Zn finger | 117..137 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 145..165 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 173..193 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 201..221 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 229..249 | CDD:275368 | 7/21 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24384 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |