DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and mynn

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_017945235.2 Gene:mynn / 101730887 XenbaseID:XB-GENE-941010 Length:649 Species:Xenopus tropicalis


Alignment Length:416 Identity:122/416 - (29%)
Similarity:185/416 - (44%) Gaps:59/416 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 YKQTAPLISPAASSVSSSTGSIRPVRDLIMSATGGAASTNISLTTVT-----------NLSLNSV 255
            |:.::|.| |:..|:.:        ::|.:.|....|..|..|.:.|           |:||:::
 Frog   238 YQLSSPKI-PSVLSLDA--------KELELMAVDHVAKDNTGLLSFTSEGDCEIFLSQNISLDTL 293

  Fly   256 QATAVGMMPKMTGGLITTAVGSNSGAIGGIGGYNATSAEEISYK-------CRICEKVFGCSETL 313
            ..|......:....:....: ||...|..:....:.. :|:..|       |..|.|||..:.:|
 Frog   294 AVTQKPAKSQQDCAMKEHCI-SNIADITNMCTMESCE-KELDQKYSKNKPVCNTCGKVFSEASSL 356

  Fly   314 QAHEKTHKSPR-YECADCGKGFSQLRNYKYHLSVHRGTKEFAAECPECGKTFNDKGYLSSHLKIH 377
            :.|.:.||..: |.|..|.|.|:|....|.|:..|.|.|.:  :|.:|.|.|..|..|..|.::|
 Frog   357 RRHMRIHKGVKPYVCHLCAKAFTQCNQLKTHVRTHTGEKPY--QCKKCDKGFAQKCQLVFHSRMH 419

  Fly   378 R-NRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRFSRKMLLKQHMRTHSGEKPYQC 441
            . ..|.|:|..|...|.......:|.|.|:|.||:.|:.||:||::...|..|:|.|:|||||.|
 Frog   420 HGEEKPYKCDVCNLQFATSSNLKIHARKHSGEKPYVCDRCGQRFAQASTLTYHVRRHTGEKPYVC 484

  Fly   442 SVCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTHLNYHTGCKPYVCPHPNCNQAF 506
            ..|||:||..|::..|.|.|:|.||:.|.:|.|:|.....|..|...|||.:|:||  ..|..::
 Frog   485 DTCGKAFAVSSSLITHARKHTGEKPYICGVCRKSFISSGELNKHFRSHTGERPFVC--EVCGNSY 547

  Fly   507 TQSSNMRTHAKKCQ------YRPLDGLTVTSS-----ALPVPGKQQTGPPP-----TLAMAMAQT 555
            |...|::.|..|..      ..|....:.:||     ..|.|...:..||.     ||.::    
 Frog   548 TDVKNLKKHKLKMHKGNEDTAEPKSADSSSSSEDSTRKSPEPESLELKPPDLFLPLTLHIS---- 608

  Fly   556 FQMPPPPGVLTPGSGPSQPPSQQTLL 581
               |..|.:|.|.| .:|..|..|||
 Frog   609 ---PDDPQMLLPVS-DNQGLSSDTLL 630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 7/19 (37%)
COG5048 <316..502 CDD:227381 72/187 (39%)
C2H2 Zn finger 327..347 CDD:275368 7/19 (37%)
zf-C2H2 356..377 CDD:278523 7/20 (35%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
zf-H2C2_2 369..394 CDD:290200 8/25 (32%)
C2H2 Zn finger 385..405 CDD:275368 5/19 (26%)
zf-H2C2_2 397..422 CDD:290200 11/24 (46%)
C2H2 Zn finger 413..433 CDD:275368 8/19 (42%)
zf-H2C2_2 426..449 CDD:290200 13/22 (59%)
zf-C2H2 439..461 CDD:278523 10/21 (48%)
C2H2 Zn finger 441..461 CDD:275368 9/19 (47%)
zf-C2H2 467..489 CDD:278523 6/21 (29%)
C2H2 Zn finger 469..489 CDD:275368 6/19 (32%)
C2H2 Zn finger 497..515 CDD:275368 4/17 (24%)
mynnXP_017945235.2 BTB_POZ_ZBTB31_myoneurin 47..157 CDD:349526
zf-C2H2 342..363 CDD:395048 7/20 (35%)
C2H2 Zn finger 343..363 CDD:275368 7/19 (37%)
zf-H2C2_2 355..380 CDD:404364 9/24 (38%)
C2H2 Zn finger 371..391 CDD:275368 7/19 (37%)
zf-H2C2_2 384..408 CDD:404364 9/25 (36%)
C2H2 Zn finger 399..419 CDD:275368 7/19 (37%)
SFP1 <422..477 CDD:227516 19/54 (35%)
C2H2 Zn finger 428..448 CDD:275368 5/19 (26%)
C2H2 Zn finger 456..476 CDD:275368 8/19 (42%)
zf-H2C2_2 469..492 CDD:404364 13/22 (59%)
C2H2 Zn finger 484..504 CDD:275368 9/19 (47%)
C2H2 Zn finger 512..532 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.