Sequence 1: | NP_609739.2 | Gene: | CG15269 / 34887 | FlyBaseID: | FBgn0028878 | Length: | 587 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_004911953.1 | Gene: | zbtb39 / 100498535 | XenbaseID: | XB-GENE-957946 | Length: | 695 | Species: | Xenopus tropicalis |
Alignment Length: | 242 | Identity: | 61/242 - (25%) |
---|---|---|---|
Similarity: | 98/242 - (40%) | Gaps: | 35/242 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 283 GGIGGYNATSAEEISYKCRICEK-VFGCSETLQAHEKTHKSPR-YECADCGKGFSQLRNYKYHLS 345
Fly 346 VHRGTKEFAAECPECGKTFNDKGYLSSHLKIHRNRKE--YECPYCPKSFNQRVAFNMHVRIHTGV 408
Fly 409 KPHKCNE-----------------CGKRFSRKMLLKQH-MRTHSGEKPYQCSVCGKSFADRSNMT 455
Fly 456 LHHRLHSGIKPFSCPLCPKAFTKKHHLKTHLNYHTGCKPY---VCPH 499 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15269 | NP_609739.2 | C2H2 Zn finger | 300..320 | CDD:275368 | 3/20 (15%) |
COG5048 | <316..502 | CDD:227381 | 56/208 (27%) | ||
C2H2 Zn finger | 327..347 | CDD:275368 | 4/19 (21%) | ||
zf-C2H2 | 356..377 | CDD:278523 | 5/20 (25%) | ||
C2H2 Zn finger | 357..377 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 369..394 | CDD:290200 | 8/26 (31%) | ||
C2H2 Zn finger | 385..405 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 397..422 | CDD:290200 | 6/41 (15%) | ||
C2H2 Zn finger | 413..433 | CDD:275368 | 4/37 (11%) | ||
zf-H2C2_2 | 426..449 | CDD:290200 | 9/23 (39%) | ||
zf-C2H2 | 439..461 | CDD:278523 | 11/21 (52%) | ||
C2H2 Zn finger | 441..461 | CDD:275368 | 10/19 (53%) | ||
zf-C2H2 | 467..489 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 469..489 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 497..515 | CDD:275368 | 2/3 (67%) | ||
zbtb39 | XP_004911953.1 | BTB_POZ_ZBTB39 | 4..126 | CDD:349533 | |
C2H2 Zn finger | 325..346 | CDD:275368 | |||
C2H2 Zn finger | 354..374 | CDD:275368 | |||
C2H2 Zn finger | 382..399 | CDD:275368 | |||
zf-C2H2 | 588..610 | CDD:395048 | 11/21 (52%) | ||
C2H2 Zn finger | 590..610 | CDD:275368 | 10/19 (53%) | ||
zf-H2C2_2 | 602..626 | CDD:404364 | 9/23 (39%) | ||
C2H2 Zn finger | 618..638 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 646..666 | CDD:275368 | 3/6 (50%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24384 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |