DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG15269 and siah3

DIOPT Version :9

Sequence 1:	NP_609739.2	Gene:	CG15269 / 34887	FlyBaseID:	FBgn0028878	Length:	587	Species:	Drosophila melanogaster
Sequence 2:	XP_002941011.1	Gene:	siah3 / 100497552	XenbaseID:	XB-GENE-6035790	Length:	241	Species:	Xenopus tropicalis

Alignment Length:	72	Identity:	19/72 - (26%)
Similarity:	28/72 - (38%)	Gaps:	26/72 - (36%)

- Green bases have known domain annotations that are detailed below.

  Fly   138 HQHQQHLPNQQKRFFAP-----YVIN-----------GSVPPPPPLQQQQQPLIR-----TKSTA 181
            |...||.  |.||.|:.     .|:|           .:||.....::::|.|.|     .:.|:
Frog    16 HLRFQHY--QAKRVFSSAGQLVCVVNPTQNLQNGSNRSAVPEEDSSERKEQYLCRQSVNDPQLTS 78

  Fly   182 CTRPDCP 188
            ||   ||
Frog    79 CT---CP 82

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID
CG15269	NP_609739.2	C2H2 Zn finger	300..320	CDD:275368
		COG5048	<316..502	CDD:227381
		C2H2 Zn finger	327..347	CDD:275368
		zf-C2H2	356..377	CDD:278523
		C2H2 Zn finger	357..377	CDD:275368
		zf-H2C2_2	369..394	CDD:290200
		C2H2 Zn finger	385..405	CDD:275368
		zf-H2C2_2	397..422	CDD:290200
		C2H2 Zn finger	413..433	CDD:275368
		zf-H2C2_2	426..449	CDD:290200
		zf-C2H2	439..461	CDD:278523
		C2H2 Zn finger	441..461	CDD:275368
		zf-C2H2	467..489	CDD:278523
		C2H2 Zn finger	469..489	CDD:275368
		C2H2 Zn finger	497..515	CDD:275368
siah3	XP_002941011.1	Sina	105..229	CDD:239753
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910