DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and ZSCAN30

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001106205.1 Gene:ZSCAN30 / 100101467 HGNCID:33517 Length:494 Species:Homo sapiens


Alignment Length:368 Identity:116/368 - (31%)
Similarity:165/368 - (44%) Gaps:47/368 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 SPYQTHQHQQHLPNQQKRFFAPYVINGSVPPPPPLQQQQQPLIRTKSTACTRPDCPECLDYYQRL 197
            ||.|..::|.....|:.:.|               |::...::..| ....:.:..||:      
Human   162 SPVQPLENQCKTETQESQAF---------------QERDGRMVAGK-VLMAKQEIVECV------ 204

  Fly   198 QTGGYKQTAPLISPAASSVSSSTGSIRPVRDLI------MSATGGAASTNISL--TTVTNLSLNS 254
                  .:|.:|||  ..:...|.|.|...:.:      ....|.||...||.  :...:.||  
Human   205 ------ASAAMISP--GKLPGETHSQRIAEEALGGLDNSKKQKGNAAGNKISQLPSQDRHFSL-- 259

  Fly   255 VQATAVGMMPKMTGGLIT-TAVGSNSGAIGGIGGYNATSAEEISYKCRICEKVFGCSETLQAHEK 318
              ||....:|.....|.: .:.||.|.....|...:..:.|:: |:|..|.|.|..|..|..|::
Human   260 --ATFNRRIPTEHSVLESHESEGSFSMNSNDITQQSVDTREKL-YECFDCGKAFCQSSKLIRHQR 321

  Fly   319 THKSPR-YECADCGKGFSQLRNYKYHLSVHRGTKEFAAECPECGKTFNDKGYLSSHLKIHRNRKE 382
            .|...| |.|.:|||.||...:...|..:|.|.|.:  ||.||||.|.....|..|.:||...|.
Human   322 IHTGERPYACKECGKAFSLSSDLVRHQRIHSGEKPY--ECCECGKAFRGSSELIRHRRIHTGEKP 384

  Fly   383 YECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRFSRKMLLKQHMRTHSGEKPYQCSVCGKS 447
            |||..|.|:|::..|...|.:||||.|.::|..|||.|.|..:|.:|.|.|:|||||:|:.||||
Human   385 YECGECGKAFSRSSALIQHKKIHTGDKSYECIACGKAFGRSSILIEHQRIHTGEKPYECNECGKS 449

  Fly   448 FADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTHLNYHT 490
            |...|.:|.|.|:|:|.||:.|..|.|.|..:..|..|...||
Human   450 FNQSSALTQHQRIHTGEKPYECSECRKTFRHRSGLMQHQRTHT 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 7/19 (37%)
COG5048 <316..502 CDD:227381 76/176 (43%)
C2H2 Zn finger 327..347 CDD:275368 7/19 (37%)
zf-C2H2 356..377 CDD:278523 9/20 (45%)
C2H2 Zn finger 357..377 CDD:275368 8/19 (42%)
zf-H2C2_2 369..394 CDD:290200 11/24 (46%)
C2H2 Zn finger 385..405 CDD:275368 6/19 (32%)
zf-H2C2_2 397..422 CDD:290200 12/24 (50%)
C2H2 Zn finger 413..433 CDD:275368 9/19 (47%)
zf-H2C2_2 426..449 CDD:290200 14/22 (64%)
zf-C2H2 439..461 CDD:278523 11/21 (52%)
C2H2 Zn finger 441..461 CDD:275368 10/19 (53%)
zf-C2H2 467..489 CDD:278523 6/21 (29%)
C2H2 Zn finger 469..489 CDD:275368 6/19 (32%)
C2H2 Zn finger 497..515 CDD:275368
ZSCAN30NP_001106205.1 SCAN 44..154 CDD:128708
SCAN 44..122 CDD:280241
COG5048 281..>360 CDD:227381 26/81 (32%)
zf-C2H2 301..323 CDD:278523 8/21 (38%)
C2H2 Zn finger 303..323 CDD:275368 7/19 (37%)
zf-H2C2_2 316..339 CDD:290200 9/22 (41%)
COG5048 <328..479 CDD:227381 68/152 (45%)
C2H2 Zn finger 331..351 CDD:275368 7/19 (37%)
zf-H2C2_2 343..366 CDD:290200 10/24 (42%)
C2H2 Zn finger 359..379 CDD:275368 8/19 (42%)
zf-H2C2_2 371..396 CDD:290200 11/24 (46%)
C2H2 Zn finger 387..407 CDD:275368 6/19 (32%)
zf-H2C2_2 399..424 CDD:290200 12/24 (50%)
C2H2 Zn finger 415..435 CDD:275368 9/19 (47%)
zf-H2C2_2 428..452 CDD:290200 15/23 (65%)
C2H2 Zn finger 443..463 CDD:275368 10/19 (53%)
zf-H2C2_2 455..480 CDD:290200 11/24 (46%)
C2H2 Zn finger 471..491 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.