DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15269 and znf1046

DIOPT Version :9

Sequence 1:NP_609739.2 Gene:CG15269 / 34887 FlyBaseID:FBgn0028878 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_017210830.1 Gene:znf1046 / 100004513 ZFINID:ZDB-GENE-030131-2092 Length:418 Species:Danio rerio


Alignment Length:277 Identity:100/277 - (36%)
Similarity:145/277 - (52%) Gaps:23/277 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 SYKCRICEKVFGCSETLQAHEKTH-KSPRYECADCGKGFSQLRNYKYHLSVHRGTKEFAAECPEC 360
            ::.|:.|.|.|.....|..|.:.| :...:.|..|||.|.|::.:|.|:.:|.|.::|.  |.:|
Zfish    81 NFSCKQCRKSFSQKSKLDVHMRVHTREQPFTCEQCGKSFGQIQGFKAHMRIHTGERKFT--CRKC 143

  Fly   361 GKTFNDKGYLSSHLKIHRNRKEYECPYCPKSFNQRVAFNMHVRIHTGVKPHKCNECGKRFSRKML 425
            .|:|...|:.::|::||...|.:.|..|.|||.|:...:.|.|:|||.||:.|.:|||.||:|..
Zfish   144 EKSFYHAGHFAAHMRIHTGEKPFSCKQCGKSFCQKPNLDDHKRVHTGEKPYTCEQCGKSFSQKQN 208

  Fly   426 LKQHMRTHSGEKPYQCSVCGKSFADRSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTHLNYHT 490
            .|.|||.|:||:||.|..|||||....|:.:|.|.|:|.|||||..|.|:|:||.:|..|:..||
Zfish   209 FKTHMRIHTGERPYTCQKCGKSFRHAINLEVHMRTHTGEKPFSCKQCRKSFSKKPNLIAHMRVHT 273

  Fly   491 GCKPYVCPHPNCNQAFTQSS----NMRTHAKKCQYRPLDGLTVTS--------SALPVPGKQQTG 543
            ..||:.|  ..|.::|:|..    :||.|..:..|      |.|.        |.|....:..||
Zfish   274 REKPHTC--EQCGKSFSQKRDLYIHMRIHTGEKPY------TCTECGKGFSHISTLKHHMRTHTG 330

  Fly   544 PPPTLAMAMAQTFQMPP 560
            ..|.......::|...|
Zfish   331 EKPFACAQCGKSFTTKP 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15269NP_609739.2 C2H2 Zn finger 300..320 CDD:275368 6/19 (32%)
COG5048 <316..502 CDD:227381 79/186 (42%)
C2H2 Zn finger 327..347 CDD:275368 8/19 (42%)
zf-C2H2 356..377 CDD:278523 6/20 (30%)
C2H2 Zn finger 357..377 CDD:275368 6/19 (32%)
zf-H2C2_2 369..394 CDD:290200 9/24 (38%)
C2H2 Zn finger 385..405 CDD:275368 8/19 (42%)
zf-H2C2_2 397..422 CDD:290200 12/24 (50%)
C2H2 Zn finger 413..433 CDD:275368 11/19 (58%)
zf-H2C2_2 426..449 CDD:290200 14/22 (64%)
zf-C2H2 439..461 CDD:278523 10/21 (48%)
C2H2 Zn finger 441..461 CDD:275368 9/19 (47%)
zf-C2H2 467..489 CDD:278523 10/21 (48%)
C2H2 Zn finger 469..489 CDD:275368 8/19 (42%)
C2H2 Zn finger 497..515 CDD:275368 6/21 (29%)
znf1046XP_017210830.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.