DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIS and SPOCD1

DIOPT Version :9

Sequence 1:NP_001260457.1 Gene:TfIIS / 34883 FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_653170.3 Gene:SPOCD1 / 90853 HGNCID:26338 Length:1216 Species:Homo sapiens


Alignment Length:213 Identity:50/213 - (23%)
Similarity:89/213 - (41%) Gaps:33/213 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 AKTLIKNWKRFLASPAPTTPNNSSAKEGSSNNSSASKSTSAAKSSSSISGKDKSSSSSSSKDKEK 133
            |:.|.:..:..:..||.......|...|::.:............|.|::..|.||..:.|    :
Human   516 AQRLRRKKRPMVQGPAGCQVFQPSPSGGTAGDPGGLSDPFYPPRSGSLALGDPSSDPACS----Q 576

  Fly   134 KGSTSSSQTSFPSG----------------GMTDAVRIKCREMLATALKIGEVPEGCGEP----- 177
            .|...:.:.|.|..                |:...|....:|:|.|.|:  |:|    :|     
Human   577 SGPMEAEEDSLPEQPEDSAQLQQEKPSLYIGVRGTVVRSMQEVLWTRLR--ELP----DPVLSEE 635

  Fly   178 --EEMAAELEDAIYSEFNNTDMKYKNRIRSRVANLKDPKNPGLRGNFMCGAVTAKQLAKMTPEEM 240
              |.:||.:|.|::.....|:.:||.:.||.:.||:||:|..|....:.|.||...|.:|:..::
Human   636 VVEGIAAGIEAALWDLTQGTNGRYKTKYRSLLFNLRDPRNLDLFLKVVHGDVTPYDLVRMSSMQL 700

  Fly   241 ASDEMKKLREKFVKEAIN 258
            |..|:.:.|::..|..:|
Human   701 APQELARWRDQEEKRGLN 718

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 50/213 (23%)
TFS2N 7..82 CDD:197766 2/12 (17%)
TFIIS_M 151..257 CDD:284835 33/112 (29%)
Zn-ribbon_TFIIS 266..312 CDD:259796
SPOCD1NP_653170.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..74
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..216
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 236..325
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 348..462
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 511..601 15/88 (17%)
TFIIS_M 608..717 CDD:284835 33/114 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 823..850
SPOC 867..965 CDD:285043
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1046..1140
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1176..1216
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.