DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIS and BYE1

DIOPT Version :9

Sequence 1:NP_001260457.1 Gene:TfIIS / 34883 FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_012921.3 Gene:BYE1 / 853865 SGDID:S000001488 Length:594 Species:Saccharomyces cerevisiae


Alignment Length:238 Identity:56/238 - (23%)
Similarity:92/238 - (38%) Gaps:58/238 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 FLASPAPTTPNNS--SAK---------EGSSNNSSASKSTSAAKSSSSISGKDKSSSSSSSKD-- 130
            ||...:|.....|  |||         :.|:.:...:||..||||.::.:.........|.|:  
Yeast   172 FLDEESPRKRKRSPDSAKGIHIKSKQVKKSNGSKKRNKSIDAAKSDTAENEMPTRKDFESEKEHK 236

  Fly   131 ----KEKKGSTSSSQTSFPSGGMTDAVRIKCREMLATALKIGEVPEG---CGEPEEMAAELEDAI 188
                .||..||..|:...|.               ....|:.|:|:|   ....:|.|..||:.:
Yeast   237 LRYNAEKMFSTLFSKFIVPE---------------TIEAKLYELPDGKDVISISQEFAHNLEEEL 286

  Fly   189 YS-----EFNNTDMKYKNRIRSRVANLKDPKNPGLRGNFMCGAVTAKQLAKMTPEEMASDEMKKL 248
            |.     ||...|..|..::||..:||||.||..|:.:.:.|.:...:|..|...|:|:.::::.
Yeast   287 YKACLNVEFGTLDKIYTEKVRSLYSNLKDKKNLELKAHVVEGKLPLNKLVNMNASELANPDLQEF 351

  Fly   249 REK------------------FVKEAINDAQLATVQGTKTDLL 273
            :||                  :||....|..:..:...:.|:|
Yeast   352 KEKRDKIILENFIVEVPDKPMYVKTHKGDELIEDIAEPQEDIL 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 56/238 (24%)
TFS2N 7..82 CDD:197766 2/2 (100%)
TFIIS_M 151..257 CDD:284835 31/131 (24%)
Zn-ribbon_TFIIS 266..312 CDD:259796 2/8 (25%)
BYE1NP_012921.3 PHD_Bye1p_SIZ1_like 74..131 CDD:277045
TFS2M 235..354 CDD:128786 33/133 (25%)
SPOC 434..589 CDD:400205
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I2908
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001112
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11477
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.