DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIS and RPC11

DIOPT Version :9

Sequence 1:NP_001260457.1 Gene:TfIIS / 34883 FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_010330.1 Gene:RPC11 / 851615 SGDID:S000002452 Length:110 Species:Saccharomyces cerevisiae


Alignment Length:68 Identity:29/68 - (42%)
Similarity:35/68 - (51%) Gaps:1/68 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 EMKKLREKFVKEAINDAQLATVQGTKTDLLKCAKCKKRNCTYNQLQTRSADEPMTTFVMCNECGN 308
            :.|||..|.|.:.:... ...|..|||.......|...:..:.|||.||||||||||..|..||:
Yeast    42 DRKKLPRKEVDDVLGGG-WDNVDQTKTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGH 105

  Fly   309 RWK 311
            |||
Yeast   106 RWK 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 29/68 (43%)
TFS2N 7..82 CDD:197766
TFIIS_M 151..257 CDD:284835 5/12 (42%)
Zn-ribbon_TFIIS 266..312 CDD:259796 23/46 (50%)
RPC11NP_010330.1 RPB9 1..110 CDD:224510 29/68 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.