powered by:
Protein Alignment TfIIS and RPC11
DIOPT Version :9
Sequence 1: | NP_001260457.1 |
Gene: | TfIIS / 34883 |
FlyBaseID: | FBgn0010422 |
Length: | 313 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_010330.1 |
Gene: | RPC11 / 851615 |
SGDID: | S000002452 |
Length: | 110 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 68 |
Identity: | 29/68 - (42%) |
Similarity: | 35/68 - (51%) |
Gaps: | 1/68 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 244 EMKKLREKFVKEAINDAQLATVQGTKTDLLKCAKCKKRNCTYNQLQTRSADEPMTTFVMCNECGN 308
:.|||..|.|.:.:... ...|..|||.......|...:..:.|||.||||||||||..|..||:
Yeast 42 DRKKLPRKEVDDVLGGG-WDNVDQTKTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGH 105
Fly 309 RWK 311
|||
Yeast 106 RWK 108
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1594 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.