DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIS and AT5G42325

DIOPT Version :9

Sequence 1:NP_001260457.1 Gene:TfIIS / 34883 FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_680377.1 Gene:AT5G42325 / 834238 AraportID:AT5G42325 Length:233 Species:Arabidopsis thaliana


Alignment Length:276 Identity:51/276 - (18%)
Similarity:99/276 - (35%) Gaps:89/276 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EVFRIQKKMSKMASDGTGQDQALDLLKALQTL-----NINLDILTKTRIGMTVNELRKSSKDDEV 65
            |:|....:.:|.........:.|..:.|:..|     ::..|::.||.:|..:. .....|:.::
plant     8 ELFEAALRAAKSVKGAESSPEVLRFVDAMNRLKEAPKSLVCDVVCKTSMGKGLG-FFIDHKNPKI 71

  Fly    66 IALAKTLIKNWKRFLASPAPTTPNNSSAKEGSSNNSSASKSTSAAKSSSSISGKDKSSSSSSSKD 130
            .:..:.|...|.:.                                  ...||::|      |:|
plant    72 RSEGRILRDLWMKI----------------------------------HYASGREK------SRD 96

  Fly   131 KEKKGSTSSSQTSFPSGGMTDAVRIKCREMLATALKIGEVPEGCGEPEEMAAELEDAIYSEFNNT 195
            :|......:..|...:|   |:.|.|..|:|.::|            .::|.|:.|        |
plant    97 RETPVKIPTHSTMKKTG---DSKRDKVHEILQSSL------------AKVATEVVD--------T 138

  Fly   196 DMKYK--------------NRIRSRVANLKDPKNPGLRGNFMCGAVTAKQLAKMTPEEMASDEMK 246
            :||.:              ....|.:.|:.|..||.||...:.|.::.::|.||..:||.|::::
plant   139 EMKRRVMTVCDPWVVAVSVESAMSILFNMGDSNNPDLRRKVLIGEISGERLVKMEKDEMGSEKIQ 203

  Fly   247 ------KLREKFVKEA 256
                  |.|.:|.:|:
plant   204 KEVQRIKERARFKEES 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 51/276 (18%)
TFS2N 7..82 CDD:197766 12/79 (15%)
TFIIS_M 151..257 CDD:284835 30/126 (24%)
Zn-ribbon_TFIIS 266..312 CDD:259796
AT5G42325NP_680377.1 TFIIS_I 11..85 CDD:238107 11/74 (15%)
TFIIS_M 118..208 CDD:295406 24/109 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1579101at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.