DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIS and AT4G18720

DIOPT Version :9

Sequence 1:NP_001260457.1 Gene:TfIIS / 34883 FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_193607.1 Gene:AT4G18720 / 827606 AraportID:AT4G18720 Length:266 Species:Arabidopsis thaliana


Alignment Length:252 Identity:57/252 - (22%)
Similarity:98/252 - (38%) Gaps:59/252 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EVFRIQKKMSKMASDGTGQDQALDLLKALQTL-----NINLDILTKTRIGMTVNELRKSSKDDEV 65
            |:|....:.:|.........:....:.|:..|     ::..|::.||.:|..: |.....|:.::
plant     8 ELFEAALRAAKSVKGDENSPEVSRFVDAMNRLKEAPKSLVCDVVCKTSMGQGL-EFFIDHKNPKI 71

  Fly    66 IALAKTLIKNWKRFLASPAPTTPNNSSAKEGSSNNSSASKSTSAAKSSSSISGKDKSSSSSSSKD 130
            .:..:.|...|.:|.         .:|.:|.|.:|..|     |.|..:..:.|           
plant    72 RSEGRILRDLWMKFF---------YASGREKSRDNREA-----AVKIPTHATMK----------- 111

  Fly   131 KEKKGSTSSSQTSFPSGGMTDAVRIKCREMLATAL-KI-GEVPE--------GCGEPEEMAAELE 185
              |.|               |:.|.|.||:|.|:| |: .||.:        .| :|..:|..:|
plant   112 --KTG---------------DSKRDKVREILQTSLAKVASEVVDTEMKTRVTAC-DPWVVAVSVE 158

  Fly   186 DAIYSEFNNTDMKYKNRIRSRVANLKDPKNPGLRGNFMCGAVTAKQLAKMTPEEMAS 242
            .|::..........|.:.||.:.|:.|..||.||...:.|.::.::|.||..|||.|
plant   159 TAMFENLGCFMGPQKAKYRSILFNMGDSNNPDLRRKVLLGEISGERLVKMEKEEMGS 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 57/252 (23%)
TFS2N 7..82 CDD:197766 13/79 (16%)
TFIIS_M 151..257 CDD:284835 33/102 (32%)
Zn-ribbon_TFIIS 266..312 CDD:259796
AT4G18720NP_193607.1 TFIIS_I 11..87 CDD:238107 12/85 (14%)
TFS2M 119..224 CDD:128786 31/98 (32%)
PKc_like <231..248 CDD:304357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.