DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIS and AT4G07950

DIOPT Version :10

Sequence 1:NP_476967.1 Gene:TfIIS / 34883 FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_192535.1 Gene:AT4G07950 / 826299 AraportID:AT4G07950 Length:106 Species:Arabidopsis thaliana


Alignment Length:71 Identity:20/71 - (28%)
Similarity:33/71 - (46%) Gaps:6/71 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 EMKK---LREKFVKEAINDAQLATVQGTKTDLLKCAKCKKRNCTYNQLQTRSADEPMTTFVMCNE 305
            |:||   |.:|.::..:....:.|...|:.   .|.:|......:..:|.||||||.:.|..|.:
plant    37 EIKKKQLLVKKSIEPVVTKDDIPTAAETEA---PCPRCGHDKAYFKSMQIRSADEPESRFYRCLK 98

  Fly   306 CGNRWK 311
            |...|:
plant    99 CEFTWR 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIISNP_476967.1 TFSII 5..313 CDD:273592 20/71 (28%)
AT4G07950NP_192535.1 RPB9 2..105 CDD:441202 20/71 (28%)

Return to query results.
Submit another query.