DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIS and phf3

DIOPT Version :9

Sequence 1:NP_001260457.1 Gene:TfIIS / 34883 FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_005157087.1 Gene:phf3 / 553518 ZFINID:ZDB-GENE-090313-207 Length:1691 Species:Danio rerio


Alignment Length:218 Identity:55/218 - (25%)
Similarity:94/218 - (43%) Gaps:28/218 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 IGMTVNELRKSSKDDEVIALAKTLIKNWKRFLASPAPTTPNNSSAKEGSSNNSSASKSTSAAKSS 113
            :|:.:.::::..|:|:.....|...:..::..||..             |::.||:|.....:.|
Zfish   653 VGLDLAKVQQMEKEDQEYVCLKCCAQEDEKTQASEL-------------SDDKSAAKQKQRPQQS 704

  Fly   114 SSISG--------------KDKSSSSSSSKDKEKKGSTSSSQTSFPS-GGMTDAVRIKCREMLAT 163
            .:..|              :|.:....:.|.:.||...|...:..|| |.:..:||....|:|..
Zfish   705 LTAGGIRPFRKDAGERRPSEDSAQKGPNVKHETKKVKISPVSSKKPSTGHIRRSVRDSLEEILLK 769

  Fly   164 ALKIGEVPEGCGEPEEMAAELEDAIYSEFNNTDMKYKNRIRSRVANLKDPKNPGLRGNFMCGAVT 228
            ..|..::......|.|:|...|..:::.|...|.||||:.||...||||.||..|....:.|.|:
Zfish   770 RSKESDLKISSDRPAEVARRTEKELFALFQGVDSKYKNKYRSLTFNLKDAKNNVLFKRVLKGEVS 834

  Fly   229 AKQLAKMTPEEMASDEMKKLREK 251
            ...|.:||.||:||.|:...|::
Zfish   835 PADLVRMTAEELASKELAAWRKR 857

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 55/218 (25%)
TFS2N 7..82 CDD:197766 4/32 (13%)
TFIIS_M 151..257 CDD:284835 35/101 (35%)
Zn-ribbon_TFIIS 266..312 CDD:259796
phf3XP_005157087.1 DUF4045 <341..732 CDD:330572 13/91 (14%)
PHD_PHF3 625..675 CDD:277108 3/21 (14%)
TFIIS_M 755..863 CDD:311443 35/103 (34%)
SPOC 1027..1176 CDD:311609
Endomucin 1271..>1449 CDD:330316
RRM 1605..>1690 CDD:330708
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.