DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIS and med26

DIOPT Version :9

Sequence 1:NP_001260457.1 Gene:TfIIS / 34883 FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001016996.1 Gene:med26 / 549750 XenbaseID:XB-GENE-1001802 Length:597 Species:Xenopus tropicalis


Alignment Length:259 Identity:59/259 - (22%)
Similarity:100/259 - (38%) Gaps:59/259 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LDLLKALQTLNINLDILTKTRIGMTVNELRKSSKDDEVIALAKTLIKNWKRFLASPAPTTPNN-- 90
            |:::.:|:...|..:.|.:||:|..:|::||.:.::|:...||.|::||::.:   .|.|.|.  
 Frog    32 LEVISSLEKYPITKEALEETRLGKLINDVRKKTSNEELAKRAKKLLRNWQKLI---EPVTQNEQL 93

  Fly    91 --------SSAKEGSSNNSSASKSTSAAKSSSSISG-KDKSSSSSSSKDKEKKGSTSSSQTSFPS 146
                    .||..|.|:|..|..:.:.......|.| ||::....:...|..|.:....:.....
 Frog    94 VRGISNLPGSANGGGSHNCKAEPTPTTLLGGKPIQGLKDRNDIQRAHSPKADKTTNRKRKGEHRD 158

  Fly   147 GGMTDAVRIKCREMLATALKIGEVPEGCGEPEEMAAELEDAIYSEFNNTDMKYKNRI-RSRVANL 210
            ||::                   .|....:|..   ||       |.|:.....|.| .|...||
 Frog   159 GGLS-------------------TPGHVSKPNH---EL-------FQNSSPPPTNGIGGSPPENL 194

  Fly   211 KDPKNPGLRGNFMCGAVTAKQLAKMTPEEMASDEMKKLREKFVKEAINDAQLATVQGTKTDLLK 274
            ..|.:.||:.|            ::.|.|  :|:..|:....|:...|...|.....| :.|||
 Frog   195 PSPLDGGLQSN------------RLEPAE--NDKHGKIPVNAVRPHTNSPGLVKHPST-SSLLK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 59/259 (23%)
TFS2N 7..82 CDD:197766 16/53 (30%)
TFIIS_M 151..257 CDD:284835 20/106 (19%)
Zn-ribbon_TFIIS 266..312 CDD:259796 4/9 (44%)
med26NP_001016996.1 TFIIS_I 14..85 CDD:238107 16/55 (29%)
Med26_M 178..414 CDD:374027 20/81 (25%)
Med26_C 419..595 CDD:374026
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.