DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIS and polr2i

DIOPT Version :9

Sequence 1:NP_001260457.1 Gene:TfIIS / 34883 FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001006013.2 Gene:polr2i / 449992 ZFINID:ZDB-GENE-041010-106 Length:126 Species:Danio rerio


Alignment Length:79 Identity:19/79 - (24%)
Similarity:35/79 - (44%) Gaps:14/79 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 KMTPEEMASDEMKKLREKFVKEAINDAQLATVQGTKTDLLKCAKCKKRNCTYNQLQTRSADEPMT 298
            |:|.|   .||:.::    :.:...|..|     .:|:...|.||..:...:.|..:..|::.|.
Zfish    58 KITHE---VDELTQI----IADVAQDPTL-----PRTEDHPCPKCGHKEAVFFQSHSMKAEDAMR 110

  Fly   299 TFVMCN--ECGNRW 310
            .:.:|.  .||:||
Zfish   111 LYYVCTAPHCGHRW 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 19/79 (24%)
TFS2N 7..82 CDD:197766
TFIIS_M 151..257 CDD:284835 5/22 (23%)
Zn-ribbon_TFIIS 266..312 CDD:259796 12/47 (26%)
polr2iNP_001006013.2 RPB9 15..126 CDD:224510 19/79 (24%)
Zn-ribbon_RPB9 75..125 CDD:259793 14/55 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.