DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIS and RpI12

DIOPT Version :9

Sequence 1:NP_001260457.1 Gene:TfIIS / 34883 FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_524439.1 Gene:RpI12 / 42563 FlyBaseID:FBgn0038903 Length:120 Species:Drosophila melanogaster


Alignment Length:100 Identity:26/100 - (26%)
Similarity:44/100 - (44%) Gaps:21/100 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 LRGNFMCGAVTAKQLAKMTPEEMASDEMK-----------KLREKFVKEAINDAQLATVQGTKTD 271
            ::||.:|  ...|:  :..|:..:.::.:           |:..:..:|:.:||....|:     
  Fly    23 VKGNVIC--YNCKK--EFQPDVYSGEKSEFTIHFNTYDPSKVFNRTKRESESDADGPVVE----- 78

  Fly   272 LLKCAKCKKRNCTYNQLQTRSADEPMTTFVMCNEC 306
             .||.||.....:|..||.|||||..|.|..|.:|
  Fly    79 -RKCPKCNHDKMSYATLQLRSADEGQTVFFTCLKC 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 25/99 (25%)
TFS2N 7..82 CDD:197766
TFIIS_M 151..257 CDD:284835 7/49 (14%)
Zn-ribbon_TFIIS 266..312 CDD:259796 15/40 (38%)
RpI12NP_524439.1 RPB9 10..119 CDD:224510 25/99 (25%)
Zn-ribbon_RPA12 73..119 CDD:259792 16/45 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.