DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIS and Phf3

DIOPT Version :9

Sequence 1:NP_001260457.1 Gene:TfIIS / 34883 FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001102261.1 Gene:Phf3 / 363210 RGDID:1304925 Length:2020 Species:Rattus norvegicus


Alignment Length:208 Identity:64/208 - (30%)
Similarity:92/208 - (44%) Gaps:36/208 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 SKDDEVIALAKTLIKNWK----RFLASPAPTTPNNSSAKEGSSNNSSASKSTSAAKSSSSI--SG 118
            |:|:|        ||.|:    |.|..  |..|..||.:          ||...||.|:::  :|
  Rat   825 SRDNE--------IKKWQLAPLRKLGQ--PLLPRRSSEE----------KSEKIAKDSAALTCAG 869

  Fly   119 KDKSSSSSSSKD--KEKKGSTSSSQTSFPSGG----MTDAVRIKCREMLATALKIGEVPEGCGEP 177
            :..:.|.:..|.  |:||..........|:..    ..|.:|...|..|...|...........|
  Rat   870 EKAARSGTHEKQETKKKKVEKGGPNVHPPAAAAIKPSADQIRQSVRHSLKDILMKRLTDSNLKIP 934

  Fly   178 EE----MAAELEDAIYSEFNNTDMKYKNRIRSRVANLKDPKNPGLRGNFMCGAVTAKQLAKMTPE 238
            ||    :|.::|..::|.|.:||.||||:.||.:.|||||||..|....:.|.||...|.:|:||
  Rat   935 EEKSAKVATKIEKELFSFFRDTDAKYKNKYRSLMFNLKDPKNNILFKKVLKGEVTPDHLIRMSPE 999

  Fly   239 EMASDEMKKLREK 251
            |:||.|:...|.:
  Rat  1000 ELASKELAAWRRR 1012

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 64/208 (31%)
TFS2N 7..82 CDD:197766 8/25 (32%)
TFIIS_M 151..257 CDD:284835 40/105 (38%)
Zn-ribbon_TFIIS 266..312 CDD:259796
Phf3NP_001102261.1 PHD_PHF3 698..748 CDD:277108
TFIIS_M 908..1018 CDD:284835 40/105 (38%)
SPOC 1193..1299 CDD:285043
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.